KEGG   Athene cunicularia (burrowing owl): 113487923
Entry
113487923         CDS       T05777                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113487923 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:acun04050]
    113487923 (TNFRSF8)
   04090 CD molecules [BR:acun04090]
    113487923 (TNFRSF8)
Cytokine receptors [BR:acun04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113487923 (TNFRSF8)
CD molecules [BR:acun04090]
 Proteins
  113487923 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 KIAA1328
Other DBs
NCBI-GeneID: 113487923
NCBI-ProteinID: XP_026718675
LinkDB
Position
21
AA seq 485 aa
MAACSLAQGLWLLLLLQDTQTAPQTSLTPSQFCDTLENWFYDEASRSCCYQCPPGYVKRK
ACPRDPEEDCMRCGPEQYVNEAFQKPQCDACVSCAKESDLVEKEPCSFNSSRVCECRPGL
FCQTPVVNTCIRCQQHTVCKPGFGVKVRGTSTNDVTCEECPSGTFSDRNSSTDTCKPHTN
CAKLNKVTLSEGNATHDQVCLDQLPTYLSPSTLSMRFSSETNNSDPRRFHKNLVTIASIL
LSATTTENPSSTPEDKALTGTFPTLAMGEMTTGGVVVWGVVLSVIVLLVGTLLFWKWKVC
KKRILILKGKPHLHSVTSHKSGLRSQGSDLVNKCAKIILSTDSGPEEKELLDRTLPLETN
NNLVSSTDKAHSPDLSLTDVAQSNGNNPDCPIDSRVRDHTNNRIEKIYIMKADTVIVGSI
SEVPSGKNCAARGCESNVDAQENMEEELAMHYPEQETESFPGNDVMVPVEEEGKEFHHPT
TATEK
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggctgcctgcagcctggcacaaggactgtggctgctgctgcttctccaggatacccag
acagccccacagacatcattaaccccatctcaattctgtgatactcttgagaactggttt
tatgatgaagcgtcacgaagctgctgttaccagtgtcccccaggctatgttaaaaggaaa
gcatgtcctagggacccagaggaagactgcatgagatgtggacctgaacaatatgtgaat
gaagcattccaaaagccacagtgtgatgcttgtgtatcatgtgcaaaagaatccgacctt
gtggagaaggagccctgctccttcaattccagccgtgtgtgtgagtgccggccaggcctg
ttctgtcagacccctgttgtgaacacctgcatacgatgccagcagcacactgtttgcaaa
cctggttttggagtcaaagtcagaggcacctcaacaaatgacgttacctgtgaagagtgc
ccttctgggaccttctctgatcgaaactccagcactgacacctgcaagccccacacaaac
tgtgccaagttaaacaaagtgacactaagcgaaggaaatgccacacatgatcaggtttgc
ctagaccagttgcccacctatctcagcccaagtactttgtccatgagattcagcagtgaa
acaaacaactctgacccaagaaggtttcacaagaacctcgtaaccattgctagtatcctc
ttaagtgccacaacaactgaaaaccccagttcaactcctgaggataaagctctgactggc
acttttcccaccttggccatgggggagatgacaacgggaggtgtagttgtttggggagtg
gttctctctgtgatagtgctacttgtgggcacgctgttattttggaaatggaaggtttgc
aagaagcggatcctcatcctcaaaggaaagccacatctgcattctgtcacttcacacaaa
tccgggctcagatctcaaggttctgatctagtgaacaaatgtgcaaagatcatactgagt
actgacagtgggccagaagagaaggagttactcgacagaaccctccctttggaaaccaac
aataacttggtctccagcacagacaaagcacatagtcctgatctgagtctgactgacgtg
gcacagagcaatgggaataacccagattgccctattgattctcgagtcagagaccacaca
aataatcgaattgaaaaaatatacatcatgaaagccgacactgttattgtggggtccatt
tcagaagtgcctagtggcaagaactgtgctgctagaggatgtgaaagtaatgttgatgcc
caggaaaacatggaagaggaactggcaatgcactatccagagcaggaaacagagtctttt
ccagggaatgatgtaatggttcccgtggaagaggagggaaaggaatttcatcaccccacc
actgccactgaaaagtga

DBGET integrated database retrieval system