KEGG   Azotobacter chroococcum: Achr_10670
Entry
Achr_10670        CDS       T03640                                 
Symbol
ffh
Name
(GenBank) Signal recognition particle protein Ffh
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_10670 (ffh)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_10670 (ffh)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_10670 (ffh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_10670 (ffh)
Enzymes [BR:acx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     Achr_10670 (ffh)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_10670 (ffh)
  Eukaryotic Sec-SRP protein
   Achr_10670 (ffh)
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N CbiA Zeta_toxin AAA_22 cobW AAA_33 AAA_16 AAA_31 AAA_30 YqeC APS_kinase TsaE Helicase_RecD ABC_tran ATP_bind_1 ArsA_ATPase 6PF2K KTI12 Thymidylate_kin AAA_5 DO-GTPase1
Other DBs
NCBI-ProteinID: AJE20548
UniProt: A0A0C4WH14
LinkDB
Position
1181549..1182925
AA seq 458 aa
MFENLTDRLSQTLRHVTGKAKLTEDNIKDTLREVRMALLEADVALPVVKEFVNRIKERAV
GTEVSKSLTPGQAFVKIVRAELEELMGAANEDLALNAAPPAVVLMAGLQGAGKTTTVGKL
ARFLKERRKKSVLVVSADIYRPAAIKQLETLAGEVGVTFFPSDASQKPVDIAQAAIREAR
LKFIDVVLLDTAGRLHVDAEMMEEIRLLHAAVKPVETLFVVDAMTGQDAANTAKAFGDAL
PLTGVVLTKVDGDARGGAALSVRYITGKPIKFIGMGEKSEALEPFHPDRMASRILGMGDV
LSLIEEAEHKLDREKAEKLTSKLKKGKGFDLEDFRDQLQQMKNMGGLGGLMDKLPAIGGI
NLAQMGSAQGVAEKQLMQMEAIINSMTPAERRDPDMISGSRKRRIALGSGTQVQDVGRLI
KQHKQMQKMMKKFSAKGGMAKMMRGMSGMFPGGRLPKV
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgttcgaaaaccttaccgatcgcctttcccagacccttcgccatgtcaccggcaaggcc
aagctgaccgaggacaacatcaaggacaccctgcgcgaggtgcgcatggccctgctcgag
gccgatgtcgcgctgccggtggtcaaggagttcgtcaatcggatcaaggagcgtgccgtc
ggcactgaggtctcgaagagcctgaccccggggcaggccttcgtgaagatcgtccgtgcc
gaactggaagagctgatgggggcggccaacgaggatctggcgctgaatgcggcgccaccg
gcggtggtgctgatggccggcctgcagggggcgggcaagaccactaccgtgggcaagctg
gcgcgtttcctcaaggagcgccgcaagaagtcggtcctggtggtttccgccgacatctat
cgtccggcagcgatcaagcagctggaaacgctggccggggaggtcggcgtcaccttcttt
ccgtccgatgccagccagaagccagtggacatcgcccaggcggcgatccgcgaggcccgg
ctcaagttcatcgacgtggtgctgctggataccgccggtcgcctgcacgtcgatgccgag
atgatggaggagatcaggctcctgcatgccgccgtcaagccggtcgagaccctcttcgtg
gtcgatgcgatgaccggccaggatgccgccaacaccgccaaggccttcggcgacgccctg
ccgctgaccggcgtggtgctgaccaaggtggatggcgatgcgcgcggcggcgcggccctg
tcggtccgctacatcaccggcaagccgatcaagttcatcggcatgggtgagaagagcgag
gcgctggaacccttccatccggaccgcatggcctcgcgcatcctcggcatgggcgacgtg
ctcagtctgatcgaggaggccgagcacaagctcgatcgcgagaaggccgagaagctcacc
agcaagctgaagaagggcaagggcttcgatctggaggacttccgcgatcagttgcagcag
atgaagaacatgggcgggctcggcgggctgatggacaagttgccggccatcggcggcatc
aatctggcgcagatgggtagtgcccagggtgtggcggagaagcagctgatgcagatggag
gcgatcatcaactccatgactccggccgagcgtcgcgatccggacatgatcagtggttcg
cgcaagcgccgcatcgccctcggctccggcacccaggtgcaggatgtcggccggctgatc
aagcagcacaagcagatgcagaagatgatgaagaagttcagtgccaaggggggcatggcc
aagatgatgcgcggcatgagcggcatgttcccgggcggccggcttcccaaggtctag

DBGET integrated database retrieval system