KEGG   Azotobacter chroococcum: Achr_10670
Entry
Achr_10670        CDS       T03640                                 
Symbol
ffh
Name
(GenBank) Signal recognition particle protein Ffh
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_10670 (ffh)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_10670 (ffh)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_10670 (ffh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_10670 (ffh)
Enzymes [BR:acx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     Achr_10670 (ffh)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_10670 (ffh)
  Eukaryotic Sec-SRP protein
   Achr_10670 (ffh)
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N CbiA Zeta_toxin AAA_22 cobW AAA_33 AAA_16 AAA_31 AAA_30 YqeC APS_kinase TsaE Helicase_RecD ABC_tran ATP_bind_1 ArsA_ATPase 6PF2K KTI12 Thymidylate_kin AAA_5 DO-GTPase1
Other DBs
NCBI-ProteinID: AJE20548
UniProt: A0A0C4WH14
LinkDB
Position
1181549..1182925
AA seq 458 aa
MFENLTDRLSQTLRHVTGKAKLTEDNIKDTLREVRMALLEADVALPVVKEFVNRIKERAV
GTEVSKSLTPGQAFVKIVRAELEELMGAANEDLALNAAPPAVVLMAGLQGAGKTTTVGKL
ARFLKERRKKSVLVVSADIYRPAAIKQLETLAGEVGVTFFPSDASQKPVDIAQAAIREAR
LKFIDVVLLDTAGRLHVDAEMMEEIRLLHAAVKPVETLFVVDAMTGQDAANTAKAFGDAL
PLTGVVLTKVDGDARGGAALSVRYITGKPIKFIGMGEKSEALEPFHPDRMASRILGMGDV
LSLIEEAEHKLDREKAEKLTSKLKKGKGFDLEDFRDQLQQMKNMGGLGGLMDKLPAIGGI
NLAQMGSAQGVAEKQLMQMEAIINSMTPAERRDPDMISGSRKRRIALGSGTQVQDVGRLI
KQHKQMQKMMKKFSAKGGMAKMMRGMSGMFPGGRLPKV
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgttcgaaaaccttaccgatcgcctttcccagacccttcgccatgtcaccggcaaggcc
aagctgaccgaggacaacatcaaggacaccctgcgcgaggtgcgcatggccctgctcgag
gccgatgtcgcgctgccggtggtcaaggagttcgtcaatcggatcaaggagcgtgccgtc
ggcactgaggtctcgaagagcctgaccccggggcaggccttcgtgaagatcgtccgtgcc
gaactggaagagctgatgggggcggccaacgaggatctggcgctgaatgcggcgccaccg
gcggtggtgctgatggccggcctgcagggggcgggcaagaccactaccgtgggcaagctg
gcgcgtttcctcaaggagcgccgcaagaagtcggtcctggtggtttccgccgacatctat
cgtccggcagcgatcaagcagctggaaacgctggccggggaggtcggcgtcaccttcttt
ccgtccgatgccagccagaagccagtggacatcgcccaggcggcgatccgcgaggcccgg
ctcaagttcatcgacgtggtgctgctggataccgccggtcgcctgcacgtcgatgccgag
atgatggaggagatcaggctcctgcatgccgccgtcaagccggtcgagaccctcttcgtg
gtcgatgcgatgaccggccaggatgccgccaacaccgccaaggccttcggcgacgccctg
ccgctgaccggcgtggtgctgaccaaggtggatggcgatgcgcgcggcggcgcggccctg
tcggtccgctacatcaccggcaagccgatcaagttcatcggcatgggtgagaagagcgag
gcgctggaacccttccatccggaccgcatggcctcgcgcatcctcggcatgggcgacgtg
ctcagtctgatcgaggaggccgagcacaagctcgatcgcgagaaggccgagaagctcacc
agcaagctgaagaagggcaagggcttcgatctggaggacttccgcgatcagttgcagcag
atgaagaacatgggcgggctcggcgggctgatggacaagttgccggccatcggcggcatc
aatctggcgcagatgggtagtgcccagggtgtggcggagaagcagctgatgcagatggag
gcgatcatcaactccatgactccggccgagcgtcgcgatccggacatgatcagtggttcg
cgcaagcgccgcatcgccctcggctccggcacccaggtgcaggatgtcggccggctgatc
aagcagcacaagcagatgcagaagatgatgaagaagttcagtgccaaggggggcatggcc
aagatgatgcgcggcatgagcggcatgttcccgggcggccggcttcccaaggtctag

KEGG   Azotobacter chroococcum: Achr_29320
Entry
Achr_29320        CDS       T03640                                 
Symbol
secA
Name
(GenBank) preprotein translocase subunit SecA
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_29320 (secA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_29320 (secA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_29320 (secA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_29320 (secA)
Enzymes [BR:acx01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Achr_29320 (secA)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_29320 (secA)
SSDB
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C Helicase_C DEAD
Other DBs
NCBI-ProteinID: AJE22346
UniProt: A0A0C4WP28
LinkDB
Position
complement(3298541..3301285)
AA seq 914 aa
MFAPLLRVLFGSKNDREVKRMRRAVRAINALEEQMVALTDEQLRTRTEEFRERLGKGETL
DQLLPEAFAVAREAGKRVMGMRHFDVQLIGAMVLHEGKIAEMRTGEGKTLVATLAVYLNA
LAGKGVHVVTVNDYLARRDANWMRPLYEFLGLSVGVVTPFQPPEEKRAAYAADITYGTNN
EFGFDYLRDNMAFSLEDKFQRELNYAVIDEVDSILIDEARTPLIISGQAEDSSQLYLQIN
ALIPQLKRHIEEEEGVVTQEGHYSVDEKTRQIELNEQGHQFIEELLTRVGLLPEGDNLYS
AHNLPLLTHVYAGLRAHVLFHRNVEYIVQGNQVLLIDEHTGRTMPGRRLSEGLHQAIEAK
EGLPIQAESQTLASTTFQNYFRLYHKLAGMTGTADTEAFEFRQIYGLDVVVIPTHRPIAR
KDFNDLVYLTQEEKYAAIIADIKECQAQGRPVLVGTASIESSEYVSQLLKKEGIAHQVLN
AKYHEKEAEIIAQAGRPGAVTIATNMAGRGTDILLGGNWEVEVASLGEPGEEQVAQIKAD
WQKRHQQVIESGGLHVIASERHESRRIDNQLRGRSGRQGDPGSSRFYLSLEDNLMRIFAS
DRVKNFMKALGMQSGEAIEHRMVTNAIEKAQRKVEGRNFDMRKQLLEFDDVANEQRKVIY
HMRNNLLVAEDIGETIAEFREEVLGAAIDQHIPPQSLPEQWDIAGLEAALQGDFGVQLPL
QQWLDEDDRLHEEALRERILEALLAAYREKEEIAGAEALRTFEKQILLRVLDDLWKDHLS
TMDHLRHGIHLRGYAQKNPKQEYKRESFELFQSLLESIKRDAIRVLSHVQVRREDPAEEE
ERLRREAEALARRMQFQHATASALAPQTEDGDLEVVEEPQAGAVPVRPEPKIGRNEPCPC
GSGKKYKHCHGQLN
NT seq 2745 nt   +upstreamnt  +downstreamnt
atgtttgcgcctttgttgagagtgctctttggaagcaagaacgatcgtgaagtcaaacgc
atgcgtcgagccgtgcgggcgatcaatgccctcgaagagcagatggtggcgctgacggac
gagcagctgcgcaccaggaccgaggagttcagggagcgtctcggcaagggcgaaaccctc
gaccagctgttgccggaggccttcgccgtcgcccgcgaagcgggcaagcgggtgatgggt
atgcgccacttcgatgtgcagctgatcggtgccatggttctgcacgaaggcaagatcgcc
gagatgcgcaccggtgaaggcaagaccctggtggcgaccctggccgtctatctcaatgct
ctggccggcaagggcgtgcacgtggtgacggtgaacgactacctggcccgccgcgacgcc
aactggatgcgcccgctgtacgagtttctcggtctttccgtcggcgtggtcacgcccttc
cagccgccggaggagaagcgcgccgcctacgctgccgacatcacctacggcaccaacaac
gagttcggcttcgactacctgcgcgacaacatggccttcagcctggaggacaagttccag
cgcgaactcaactatgcggtgatcgacgaggtcgactccatcctgatcgacgaggcgcgc
acgccgttgatcatttccggccaggccgaggacagctcccagctgtacctgcagatcaac
gccctgattccgcagctgaagcgccacatcgaggaagaggagggtgtggtcacccaggag
gggcactacagcgtcgacgagaagacccggcagatcgagctgaacgagcagggccaccag
ttcatcgaggagctgctgacccgcgtcggcctgctgcccgagggcgacaacctctactcc
gctcacaacctgccgctgctgacccatgtctatgcaggcctgcgcgcgcacgtcctgttc
catcgcaacgtcgagtacatcgtgcagggcaaccaggtgctgctgatcgacgagcacacc
ggccggaccatgcccggccgccgcctctccgaggggctgcaccaggccatcgaggccaag
gaggggctgccgatccaggcggaaagccagactctggcctcgaccaccttccagaactac
ttccgcctctaccacaagctcgccggcatgaccggcaccgccgacaccgaggccttcgag
ttccgccagatctacggtctcgacgtggtggtgatcccgacccaccggccgatcgcgcgc
aaggacttcaacgacctagtctacctgacccaggaagagaagtacgcggcgattatcgcc
gatatcaaggagtgccaggcccaggggcgcccggttctggttgggaccgcctcgatcgag
agttccgaatacgtttcccagctgctgaagaaggaaggtatcgcgcaccaggtgctcaat
gccaagtatcacgagaaggaagccgagatcatcgcccaggccggtcgtcccggtgcggtg
accatcgccaccaacatggccggccggggtacggacatcctcctcggcggcaactgggag
gtcgaggtcgcgtcgctgggcgagccgggcgaagagcaggtcgcgcagatcaaggccgac
tggcagaagcgccaccagcaggtgatcgagtccggcggactgcatgtgatcgcctccgag
cgccatgagtcccggcgcatcgacaaccagctgcgcggccggtccggccgtcagggcgac
ccgggctccagccgcttctacctgtccctggaagacaatctgatgcgcatcttcgcctcc
gaccgggtgaagaacttcatgaaggcgctcggcatgcagtccggtgaggccatcgagcac
cgcatggtgaccaatgccatcgagaaggcccagcgcaaggtcgagggccgcaacttcgac
atgcgcaagcagctgctcgaattcgacgacgtggccaacgagcagcgcaaggtgatctac
cacatgcgcaacaacctgctggtggccgaggacatcggcgaaaccatcgccgaattccgc
gaggaggtgctgggcgccgccatcgaccagcacattccgccgcagtcgctgcccgagcag
tgggacatcgccggtctggaagccgccctgcagggtgatttcggcgtgcagctgccgttg
cagcaatggctcgacgaggacgacaggctccatgaggaggcgttgcgcgagcgcatcctc
gaggcgctgctggcggcctaccgggagaaggaggagatcgctggcgccgaagccttgcgc
accttcgagaagcagatcctgctgcgcgtgctggacgacctgtggaaggatcatctgtcg
accatggatcacctgcgccacggcatccacctgcgcggctacgcgcagaagaatcccaag
caggaatacaagcgcgagtccttcgagctgttccagtccctgcttgagtcgatcaagcgc
gatgccatccgcgtgctctcccatgtgcaggtccgccgcgaggatccggccgaggaagag
gagcgtctgcgccgcgaggccgaggccctggcccggcgcatgcagttccagcatgccact
gcttcggccctggccccgcagacggaggacggcgacctcgaggtcgtcgaggagccccag
gcgggcgccgtgccggtgcgccccgagccgaagatcgggcgcaacgagccctgtccctgc
gggtccggcaagaagtacaagcactgccacgggcagctcaactag

KEGG   Azotobacter chroococcum: Achr_34870
Entry
Achr_34870        CDS       T03640                                 
Symbol
secY
Name
(GenBank) preprotein translocase, SecY subunit
  KO
K03076  preprotein translocase subunit SecY
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_34870 (secY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_34870 (secY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_34870 (secY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_34870 (secY)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_34870 (secY)
SSDB
Motif
Pfam: SecY DUF6185
Other DBs
NCBI-ProteinID: AJE22890
UniProt: A0A0C4WTD5
LinkDB
Position
complement(3886042..3887370)
AA seq 442 aa
MAKQGALSALSNGGLSELWARLRFLFLAIIVYRIGAHIPVPGINPDRLAELFQQNEGTIL
SLFNMFSGGALERMSIFALGIMPYISASIIMQLMTVVSPQLEQLKKEGEAGRRKISQYTR
YGTLVLAIIQAFGMSVGLASQGVAFAADFSFHFVAVTTFVAGAMFMMWLGEQITERGVGN
GISMLIFAGIVAGLPAAIGQSFESARQGDINIIALLSVALLAVAIIGFVVFVERGQRRIA
VHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFASSILLFPASLGSWFGQSEGMGWLQD
IAQAIAPGQPLNILLFSVGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARY
IDGVLTRLTIFGALYMTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLV
SHQYESLMKKSNLKGYGGGMLR
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggctaagcaaggtgctctctccgcactcagcaatggcgggctgtccgagctctgggct
cggctgcggttcctgttcctggcgatcatcgtctatcgcataggcgcgcatatcccggtg
ccaggaatcaatcccgacaggctggcggaactgttccagcagaacgagggaaccattctt
agcctgttcaacatgttctccggtggcgcgctggagcggatgagcatctttgcgctgggg
atcatgccgtatatttcggcatcgatcatcatgcagctgatgaccgtggtcagcccccag
ctggagcagttgaagaaggagggcgaggccggtcgtcgcaagatcagccagtacacccgc
tacgggacacttgttctggcgattatccaggccttcggcatgtccgtcggtctggccagt
cagggcgtcgccttcgccgccgatttcagcttccacttcgtggctgtgaccaccttcgtg
gctggtgcgatgttcatgatgtggctgggtgagcagattaccgagcgaggcgtcggcaat
ggcatctcgatgctgatctttgccgggatcgtggccggtctgccggcagcgatcggtcag
tcgttcgagtctgcccgtcagggcgatatcaatatcattgctctgctgtctgtcgcgctg
ctggctgtagcgatcatcggcttcgtggttttcgtcgagcgtggccagcgacgtattgcg
gtgcactatgccaagcgtcagcagggtcgcaaggtttttgctgcgcagaccagccacttg
ccgctgaaggtgaatatggcgggggtcattccggccattttcgctagcagcatcctgctg
ttcccagcttcgctggggtcctggtttggtcagtcggaaggcatgggctggctgcaggac
attgcccaggccatcgcgcccggtcagccattgaatatcctcctgttcagtgtggggatc
attttcttctgcttcttctacactgcgctgatgttcaatcccaaggatgtggcggaaaac
ctgaaaaaatcgggcgctttcattccgggcatcaggccgggtgagcagtcggcgcgctat
atcgatggtgtgctgacccgcttgaccatttttggcgctctctacatgacggcggtctgt
ctgctcccacagttcctggtggtggcagccaacgtgccgttctatcttggcgggacttcg
ttgctgatcgtggtggtggttgtgatggacttcatgtcgcaagtacaatcgcacctcgtt
tcgcaccagtacgaatccctgatgaagaaaagcaacctgaagggctatggcggcggcatg
ctccgctga

KEGG   Azotobacter chroococcum: Achr_35230
Entry
Achr_35230        CDS       T03640                                 
Symbol
secE
Name
(GenBank) Preprotein translocase subunit SecE
  KO
K03073  preprotein translocase subunit SecE
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_35230 (secE)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_35230 (secE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_35230 (secE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_35230 (secE)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_35230 (secE)
SSDB
Motif
Pfam: SecE DUF3397 DUF4271 VIT1 DUF1616 TPPK_C DUF4191
Other DBs
NCBI-ProteinID: AJE22923
UniProt: A0A0C4WJV5
LinkDB
Position
complement(3912675..3913043)
AA seq 122 aa
MNAKAEAKESRFDLVKWLVVVVLVAVGVVGNQLYSEESILYRVIALLVLGVVAAFVALKT
SKGQAFFSLAKEARAEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSMI
VG
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaatgccaaggctgaagctaaagagtctcgctttgatttggtgaagtggctcgtggtg
gtggtcttggtcgcagtgggtgtagttggtaatcagctatactccgaagagtccatcctg
tatcgcgttatcgcattgctggttctgggggttgtggcggccttcgttgcgctcaagacc
agtaaggggcaggcttttttctctctggcgaaagaagcgcgtgccgaaattcgcaaggtt
gtctggccgacccgtcaagagactacgcagaccacgttgatcgtggtggctgtagttctg
gtgatggcgctactgctgtgggggcttgattccctgcttggttggctggtctccatgatc
gttggttaa

KEGG   Azotobacter chroococcum: Achr_36400
Entry
Achr_36400        CDS       T03640                                 
Symbol
secB
Name
(GenBank) preprotein translocase subunit SecB
  KO
K03071  preprotein translocase subunit SecB
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_36400 (secB)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_36400 (secB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_36400 (secB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:acx03110]
    Achr_36400 (secB)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_36400 (secB)
Chaperones and folding catalysts [BR:acx03110]
 Other chaperones and cochaperones
  SecB
   Achr_36400 (secB)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_36400 (secB)
SSDB
Motif
Pfam: SecB
Other DBs
NCBI-ProteinID: AJE23033
UniProt: A0A0C4WK25
LinkDB
Position
complement(4051785..4052276)
AA seq 163 aa
MTEQASNGAAQDGQNAQFSLQRIYVRDLSFEAPKAPEIFRQDWKPSVQLDLNTKQKPLNG
GDFYEVVLTLSVTVKTGEEVAFIAEVQQAGIFLIKGLDADAMAHTLGAFCPSLLFPYARE
ALDNLVVRGSFPALMLAPVNFDVLYAQELARMQAEGQASGTVQ
NT seq 492 nt   +upstreamnt  +downstreamnt
atgactgaacaagctagcaacggcgccgcacaagacggccagaacgcccaattctccctg
cagcgcatctacgtgcgcgacctctccttcgaggctccgaaggccccggagatcttccgc
caggactggaagccgagcgtccagctggacctgaataccaagcagaagccgctcaacggc
ggcgacttctacgaggtggtgctgaccctctcggtcaccgtgaagactggcgaggaggtg
gccttcatcgccgaggtgcagcaggccggcatcttcctgatcaagggcctggatgccgat
gccatggctcataccctgggcgccttctgcccgagcctgctcttcccctacgctcgcgag
gcgctggacaacctggtcgtgcgcggctccttcccggccctgatgctggcgccggtgaac
ttcgacgtgctctacgcccaggaactggcgcgcatgcaggccgagggccaggcatcgggc
acggtgcagtaa

KEGG   Azotobacter chroococcum: Achr_37470
Entry
Achr_37470        CDS       T03640                                 
Symbol
ftsY
Name
(GenBank) Signal recognition particle receptor FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_37470 (ftsY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_37470 (ftsY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_37470 (ftsY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_37470 (ftsY)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_37470 (ftsY)
SSDB
Motif
Pfam: SRP54 SRP54_N Zeta_toxin AAA_30 AAA_22 MeaB DUF2075 APS_kinase AAA_17 AAA_33 AAA_16 ABC_tran Thymidylate_kin VirC1 CbiA AAA_31 MMR_HSR1 AAA_19 YqeC AAA DO-GTPase2 DO-GTPase1 Fer4_NifH AAA_24 MobB NTPase_1 cobW Keratin AAA_18 ResIII NACHT Arf ArsA_ATPase ATP_bind_1 AAA_7 AAA_28
Other DBs
NCBI-ProteinID: AJE23137
UniProt: A0A0C4WW63
LinkDB
Position
complement(4163106..4164494)
AA seq 462 aa
MFGSNDDKKPAEAGEKKGLFGWFRKKEQSAPAPAPEEAAPEAGSEEPSPAEEAAEAARPA
EPEPQPAVVEVPAPVVEVQPETPAVGSSVPEVADQAPAAPEEEVVFSSRWRGAAHGTPAP
AAEAAPVSEPEPLPAVEAEPAVPVAQPAPRPNKSGFFARLRQGLAKTGSTLGEGMASLFL
GEKAIDDELLEELETRLLLADVGVEATTAIIQSLTLRVARKELADSEALYRALQEELTAL
LKPVEQPLALESAQRPYVILVVGVNGAGKTTTIGKLAARLQQDGKKVMLAAGDTFRAAAV
EQLQVWGERNRIPVIAQHTGADSASVIFDALQAAKARGMDVLIADTAGRLHTKDNLMEEL
KKVRRVLGKLDDAAPHEVLLVLDAGTGQNAINQTRQFNQAVEVTGLALTKLDGTAKGGVI
FALAKQFGLPIRYIGVGEGVDDLRTFVAEEFVRALFAEKPAQ
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtttggttcaaacgacgacaagaagccggccgaggccggagagaagaaaggcctgttc
ggctggttccgcaagaaggaacaatccgcaccggcgcccgcccccgaggaagctgctccg
gaagccggcagcgaagaaccgtcgccggcggaggaagccgccgaggccgcccgcccggcc
gagcccgagccgcagccggcggtggtcgaggtgccggcgccggtggtcgaggtgcagccg
gagaccccggctgtcggatcgtccgtgcccgaggtcgccgaccaggcgcctgccgcaccc
gaagaggaagtggtcttctccagccgctggcgcggcgccgcgcacggcacgccggctccc
gccgcggaagcggcgccggtgagcgagcccgagccgctgccggcggtcgaggccgagccg
gccgtcccggtcgcccagcccgccccgcggccgaacaagtccggcttcttcgcccgcctg
cgccaggggctggcgaagaccggctcgactctcggcgaaggcatggccagcctgtttctc
ggcgagaaggcgatcgacgacgagctcctggaggagctggaaacccgcctgctgctcgcc
gacgtcggtgtcgaggccaccacggcgatcatccagagcctgaccctgcgggtggcgcgc
aaggagctggccgacagcgaggcgctgtaccgcgcgctgcaggaggagctgaccgcgctg
ctcaagccggtcgagcagccgctggcgctcgagtccgcgcagcgcccctatgtgatcctg
gtggtcggcgtcaacggcgccggcaagaccaccaccatcggcaagctggccgcgcgcctg
cagcaggatggcaagaaggtcatgctcgccgccggcgacaccttccgcgccgccgccgtc
gagcagctgcaggtgtggggcgagcgcaaccggattccggtgatcgcccagcacaccggc
gcggattccgcctcggtgatcttcgatgccctgcaggccgccaaggcgcgcggcatggac
gtgctgatcgccgataccgccggtcgcctgcacaccaaggacaatctcatggaggagctg
aagaaggtccgccgggtgctcggcaagctggacgacgcggcgccccacgaggtgctgctg
gtgctggacgccggcaccggccagaacgccatcaaccagaccaggcagttcaaccaggcg
gtggaggtcaccggcctggcgctgaccaagctggacggcaccgccaagggcggggtgatc
ttcgccctggccaagcagttcggcctgccgatccgctacatcggcgtcggcgagggcgtc
gacgacctgcgcaccttcgtcgccgaggagttcgtccgcgcgctgttcgcggagaagccg
gcgcaatga

KEGG   Azotobacter chroococcum: Achr_40770
Entry
Achr_40770        CDS       T03640                                 
Name
(GenBank) putative inner membrane protein translocase component YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_40770
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_40770
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_40770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acx03029]
    Achr_40770
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_40770
Mitochondrial biogenesis [BR:acx03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    Achr_40770
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_40770
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP DUF4381
Other DBs
NCBI-ProteinID: AJE23462
UniProt: A0A0C4WWW7
LinkDB
Position
complement(4588843..4590516)
AA seq 557 aa
MDIKRSILLVALAVVSYLLVLQWNQDYGQAPLPPQNAVAQNATPALPEAASATPSASVDV
PTAGSETRTLDTAVGTASPDLIQVRTDVLEVAIDPRGGDIVQLKLPQFPRRQDHPEIPFQ
LFDNGSERLYLAQSGLTGASGPDARASGRPLYVSEQRSYQLADGQDSLVVELKFSEAGVD
YTKRFTFKRGAYDLEVRHLIANHGEQPWSGNLFAQLKRDASADPSSTTATGTATYLGAAL
WTADEPYKKVSMGDMDDKSLRETVQGGWIAWLQHYFVTAWVPNKDDSNLVTTRKDSQGNY
IIGFTGPALNIPAGASGETVTRLYAGPKNQKQLEALSPGLELTVDYGFLWFIAQPIFWLL
GVIHALLGNWGWSIIVLTIIIKLAFFPLSAASYRSMGRMRAVAPKLQALKEQHGEDRQKM
SQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWLGWIVDLSIKDPY
FILPIIMGATMFFQQTLNPTPPDPMQARVMKLMPIIFTFFFLWFPAGLVLYWVVNNVLSI
GQQWYITRQIEKAAQQA
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggatatcaaacgctcgatcctgctcgtcgccctggcagtcgtgtcctacctgctggtt
ttgcagtggaaccaggattacggccaggcaccgctaccgccccagaatgctgttgcccag
aacgccacgccggccctgccggaagccgcgtccgccaccccgtcggccagcgtggacgtt
cccaccgccggcagtgaaacccggacgctggacaccgcggtgggcaccgccagtcccgac
ctgatccaggtccgcaccgatgtgctggaagtggccatcgatccgcgcggtggcgacatc
gtgcagctcaagctgccccagtttccgcgtcgccaggaccatccggagatccccttccag
ctgttcgacaacggcagcgaacgcctgtacctggcgcagagtggactgaccggcgccagc
ggtccggacgcccgcgccagcggacgtccgctgtacgtcagcgagcagcgcagctaccag
ctggccgacggacaggacagcctggtggtcgagctgaaattcagcgaggccggcgtcgat
tacaccaagcgcttcaccttcaagcgcggcgcgtacgacctggaagtccgccacctgatc
gccaaccacggcgagcagccctggagcggcaacctgttcgcccagctcaagcgcgatgcc
agcgccgacccgtcctcgaccaccgcgaccggcaccgccacctacctgggggccgcgctg
tggactgccgacgagccgtacaagaaggtgtccatgggcgacatggacgacaagagcctg
cgcgaaaccgtgcagggtggctggatcgcctggctgcaacactacttcgtgaccgcctgg
gtaccgaacaaggatgacagcaacctggtcaccactcgcaaggacagccagggcaactac
atcatcggcttcaccggtccggcgctgaacatcccggccggtgccagcggcgaaaccgtt
acccgcctgtatgccggtccgaagaaccagaagcagctcgaggccctctcgccgggcctc
gagctgaccgtcgactacggcttcctgtggttcatcgcccagccgatcttctggctgctc
ggcgtcatccatgccctgctgggcaactggggctggtcgatcatcgtcctgaccatcatc
atcaagctggccttcttcccgctctcggcggccagctaccgctcgatgggccgcatgcgc
gcggtcgcgcccaagctgcaggccctgaaggaacagcacggcgaggatcgccagaagatg
tcccaggcgatgatggagctgtacaagaaggagaagatcaacccgctcggcggctgcctg
ccgatcctggtgcagatgccggtattcctcgctctctactgggtgctgctggaaagcgtg
gagatgcgccaggcgccctggctgggctggatcgtcgacctgtcgatcaaggatccgtac
ttcatcctgccgatcatcatgggcgcgaccatgttcttccagcagacgctcaacccgacg
ccgccggatcccatgcaggcccgggtgatgaagctgatgccgatcatcttcaccttcttc
ttcctctggttcccggctggtctggtgctgtactgggtggtcaacaacgtcctctccatc
ggtcagcagtggtacattacccggcagatcgagaaggctgcgcagcaggcctga

KEGG   Azotobacter chroococcum: Achr_7780
Entry
Achr_7780         CDS       T03640                                 
Symbol
secG
Name
(GenBank) Preprotein translocase subunit SecG
  KO
K03075  preprotein translocase subunit SecG
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_7780 (secG)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_7780 (secG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_7780 (secG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_7780 (secG)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_7780 (secG)
SSDB
Motif
Pfam: SecG
Other DBs
NCBI-ProteinID: AJE20276
UniProt: A0A0C4WK00
LinkDB
Position
869771..870160
AA seq 129 aa
MLETETIVIVFHLLAALGVVALVLIQQGKGAEAGASFGSGASATVFGSQGSSTFLSRVTA
ILATAFFLTSLGLGFLAKEKADSLSQAGLPDPAVLEIQQKKPAVEDVPVLEGQGAAGNAV
DVPQAPEQK
NT seq 390 nt   +upstreamnt  +downstreamnt
atgctggaaacggaaacgatcgttatcgtctttcatctgctggctgcgctgggtgtggtt
gcgctagttctgattcagcagggtaagggggcggaagcaggtgcttcttttggttctggt
gcgtcggctacggtttttggtagtcaaggttcctctacctttctgagtcgcgttactgct
atactcgccaccgcttttttcttgaccagtttggggttgggttttttggccaaggaaaaa
gctgactcgttgagtcaggctggtctgccggatccggcggtgctggaaatccagcagaag
aagccagcagtggaagatgtgccggtgcttgaggggcaaggggctgcaggcaatgccgta
gacgtgccgcaggctccggagcagaaataa

KEGG   Azotobacter chroococcum: Achr_9960
Entry
Achr_9960         CDS       T03640                                 
Symbol
yajC
Name
(GenBank) Preprotein translocase subunit YajC
  KO
K03210  preprotein translocase subunit YajC
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_9960 (yajC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_9960 (yajC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_9960 (yajC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_9960 (yajC)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_9960 (yajC)
SSDB
Motif
Pfam: YajC DUF2642
Other DBs
NCBI-ProteinID: AJE20477
UniProt: A0A0C4WQD4
LinkDB
Position
1102849..1103184
AA seq 111 aa
MSFLIPAAYAEAAAPAGAPPGTGFEWIFLVGFLVIFYFMIWRPQAKRAKEHKNLLGGLQK
GDEVVTSGGIAGRVSKVADDFIVLEVSDTVELKIQKGAIVASLPKGTLKAI
NT seq 336 nt   +upstreamnt  +downstreamnt
atgagttttctgattcccgccgcctatgccgaagctgctgcccccgcaggcgccccgccg
ggtaccggcttcgagtggatcttcctggtcggtttcctggtcatcttctacttcatgatc
tggcgtccccaggccaagcgtgccaaggagcacaagaacctgctcggcggcctgcagaag
ggcgatgaagtggtgaccagcggcggcatcgccgggcgggtgagcaaggtggccgacgat
ttcatcgtactggaagtctccgataccgtggagctgaagatccagaagggcgcgatcgtc
gcctccctgcccaagggcaccctgaaagccatctaa

DBGET integrated database retrieval system