KEGG Orthology (KO) [BR:acx00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
Achr_29320 (secA)
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
Achr_29320 (secA)
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
Achr_29320 (secA)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:acx02044]
Achr_29320 (secA)
Enzymes [BR:acx01000]
7. Translocases
7.4 Catalysing the translocation of amino acids and peptides
7.4.2 Linked to the hydrolysis of a nucleoside triphosphate
7.4.2.8 protein-secreting ATPase
Achr_29320 (secA)
Secretion system [BR:acx02044]
Sec (secretion) system
Prokaryotic Sec-SRP core components
Achr_29320 (secA)
163 aa
MTEQASNGAAQDGQNAQFSLQRIYVRDLSFEAPKAPEIFRQDWKPSVQLDLNTKQKPLNG
GDFYEVVLTLSVTVKTGEEVAFIAEVQQAGIFLIKGLDADAMAHTLGAFCPSLLFPYARE
ALDNLVVRGSFPALMLAPVNFDVLYAQELARMQAEGQASGTVQ