KEGG   Azotobacter chroococcum: Achr_11150
Entry
Achr_11150        CDS       T03640                                 
Name
(GenBank) Response regulator (OmpR family) in two-component regulatory system with KdpD, regulation of potassium translocation
  KO
K07667  two-component system, OmpR family, KDP operon response regulator KdpE
Organism
acx  Azotobacter chroococcum
Pathway
acx02020  Two-component system
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Achr_11150
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_11150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:acx02022]
    Achr_11150
Two-component system [BR:acx02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   Achr_11150
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-ProteinID: AJE20596
UniProt: A0A0C4WKJ3
LinkDB
Position
complement(1229107..1229835)
AA seq 242 aa
MGNPLHPETEALMSTPTPRVIIVEDEANLRRFVRLALEAEGCEVHEADSVRRGLIEAGTR
KPDLLILDLGLPDGDGIELIRDLRTWSDIPVVVLSARTAEAEKVTALDAGADDYLSKPFG
SAELLARVRAHLRRHRSGAEGAESVRFGPVRIDFGRRLVEKDGQPVHLTPIEFRLLAYLV
SNPDCVLTHRQLLKAVWGPTHAEDSHYVRVYMGHLRKKIENDPASPDFILTEPGVGYRFQ
MQ
NT seq 729 nt   +upstreamnt  +downstreamnt
atgggcaatccccttcacccggaaactgaagccctcatgtccacgccaacgccgcgagtg
atcatcgtcgaggacgaagccaacctgcgccgcttcgtgcgcctggccctggaagccgag
ggctgcgaggtccacgaggcggactcggtcaggcgcgggctgatcgaggcggggacccgc
aagcccgacctgctcatcctcgacctcggcctgccggacggggacggcatcgagctgatc
cgggatctgcggacctggtccgacatcccggtcgtcgtgctgtcggcccgcaccgccgag
gcggaaaaggtcaccgccctggatgcgggggccgacgactacctgtcgaagcccttcggc
tccgccgagctgctggcccgggtccgggcgcacctcaggcggcaccgcagcggcgccgag
ggagcggagtcggtccgcttcggcccggtgcggatcgacttcgggcggcgcctggtggaa
aaggacggccagcccgtccatctcacgccgatcgagttccgcctgctggcctacctggtc
tcgaacccggactgcgtgctgacccaccggcaactgctcaaggcggtctggggtcccacc
cacgccgaggacagccattacgtccgcgtctacatgggccatctgcgcaagaagatcgaa
aacgatccggccagccccgacttcatcctgaccgagcccggggtgggctaccgcttccag
atgcaatag

KEGG   Azotobacter chroococcum: Achr_19810
Entry
Achr_19810        CDS       T03640                                 
Symbol
kdpE
Name
(GenBank) Two-component system response regulator KdpE
  KO
K07667  two-component system, OmpR family, KDP operon response regulator KdpE
Organism
acx  Azotobacter chroococcum
Pathway
acx02020  Two-component system
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Achr_19810 (kdpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_19810 (kdpE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:acx02022]
    Achr_19810 (kdpE)
Two-component system [BR:acx02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   Achr_19810 (kdpE)
SSDB
Motif
Pfam: Response_reg Trans_reg_C MarR_2
Other DBs
NCBI-ProteinID: AJE21436
UniProt: A0A0C4WM92
LinkDB
Position
2206756..2207454
AA seq 232 aa
MNSAQQSILVIEDEAQIRKFLRISLVAQGYRVLEAGCGREGLAQAREAQPDLLVLDLGLP
DMDGQELLVELRRDSQVPVLVLSVRAGDGEKVLALDGGANDYVTKPFSIRELLARVRVLL
RRTSPPGQSPGTVQCGPLTVDLDGRRVGLGGRDIALTRKEYDVLAALARHPGRVVTQQQL
LRDIWGPTHVEDSHYLRVVVGHLRQKLGDDPADPRFIVTEAGIGYRLREHAP
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaacagtgcccagcagagcatcctggtgatcgaggacgaggcgcagatccgcaagttc
ctgcgcatcagcctggtcgcccagggctaccgggtgctggaggccggctgcggccgcgag
gggctggcacaggcccgcgaggcgcagcccgacctgctggtgctcgacctcggcctgccg
gacatggatggccaggagctgctcgtcgagctgcgccgggactcccaggtgccggtgctg
gtgctttcggtgcgcgccggcgacggcgagaaggtgctggcgctggacggtggcgccaac
gactacgtgaccaagcccttcagcatccgcgagctgctcgcccgggtgcgcgtgctgctg
cgccggacgtctccgcccgggcagtcgccgggcacggtgcagtgcggcccgctgacggtg
gacctggacggccggcgggtcggcctcggcggtcgggacatcgccctgacccgcaaggaa
tacgacgtgctggccgcgctcgcccgccacccggggcgggtcgtcacccagcagcagctg
ctccgcgacatctggggaccgacccatgtcgaggacagccactacctgagggtggtggtc
ggccacctgcgccagaagcttggcgacgaccccgccgatccccgtttcatcgtcaccgag
gccggcatcggctaccgcctgcgcgagcatgccccgtga

KEGG   Azotobacter chroococcum: Achr_31580
Entry
Achr_31580        CDS       T03640                                 
Name
(GenBank) KDP operon transcriptional regulatory protein kdpE
  KO
K07667  two-component system, OmpR family, KDP operon response regulator KdpE
Organism
acx  Azotobacter chroococcum
Pathway
acx02020  Two-component system
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Achr_31580
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_31580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:acx02022]
    Achr_31580
Two-component system [BR:acx02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   Achr_31580
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-ProteinID: AJE22567
UniProt: A0A0C4WV83
LinkDB
Position
3539683..3540372
AA seq 229 aa
MSETPTILLVEDDRQIRELVAATLEGEGYAVVEAGTAAQGAVEAGACKPDLLILDLGLPD
RNGINFIRDYRIWSAVPILILSARSQEISKVTALDAGADDYLTKPFGVSELLARVRALLR
RTPAEREQLEPIIEFGDCRIDCVHRLVTRAGEPLHLTDIQYRLLILLASNPGRVLTHRQL
LLQIWGSRALENNQYLRIYVGHLRQKIERIPAQPQHILTEIGVGYRFQP
NT seq 690 nt   +upstreamnt  +downstreamnt
atgagcgaaaccccgaccatcctgctggtagaggacgaccggcagatccgcgaactggtg
gccgccaccctggaaggcgaaggctatgccgtcgtcgaggccggcaccgccgcccagggc
gcggtggaggccggcgcctgcaagccggacctcttgatcctcgacctgggcctgccggac
cgcaacggcatcaacttcatccgcgactaccggatctggtccgcggtcccgatcctgatc
ctctccgcgcgctcccaggagatcagcaaggtcaccgccctggatgcgggcgccgacgac
tacctgaccaagcccttcggggtgtccgagctgctggcgcgggtgcgcgccctgctgcgg
cgtacccctgcggagcgggagcagctggagccgatcatcgagttcggcgactgccggatc
gactgcgtgcaccgcctggtcacccgcgccggcgagcccctgcacctgaccgacatccag
taccgcctgctgatcctgctggcctcgaaccccggccgggtgctcacccaccgccagctg
ctgctgcagatctggggcagtcgcgcgctggagaacaaccagtacctgcggatctacgtg
ggccacctgcggcagaagatcgagcgcatccccgcccagccgcagcacatcctcaccgag
atcggcgtcggctaccgcttccagccctga

DBGET integrated database retrieval system