KEGG   Azotobacter chroococcum: Achr_1140
Entry
Achr_1140         CDS       T03640                                 
Symbol
glyQ
Name
(GenBank) glycyl-tRNA synthetase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_1140 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acx01007]
    Achr_1140 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acx03016]
    Achr_1140 (glyQ)
Enzymes [BR:acx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Achr_1140 (glyQ)
Amino acid related enzymes [BR:acx01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Achr_1140 (glyQ)
Transfer RNA biogenesis [BR:acx03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Achr_1140 (glyQ)
SSDB
Motif
Pfam: tRNA-synt_2e Lipase_C
Other DBs
NCBI-ProteinID: AJE19628
UniProt: A0A0C4WFR5
LinkDB
Position
129172..130128
AA seq 318 aa
MIFVSQTTPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTATFLRAIGPETWN
AAYVQPSRRPADGRYGENPNRLQHYYQFQVVLKPNPDDIQDLYLESLRRIGIDTHVHDVR
FVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTGEITYGLERLAMYLQ
GVDSVYDLVWTDGPFGKVTYGDVFHQNEVEQSTYNFEHANVAKLFELFDFYESEANRLIA
LELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLARAVAQSYLLARAKLGFP
MAPPELRDEVLAKLEAAE
NT seq 957 nt   +upstreamnt  +downstreamnt
gtgatttttgtgagccagactacgcctgccgtgcgcaccttccaagacctgattctcgcc
ctgcagaactactgggccgaacagggttgcgtggtgctgcagccctacgatatggaagtg
ggcgccggcaccttccacaccgccacctttctgcgcgccatcggcccggaaacctggaac
gccgcctacgtgcagccttcgcgccgcccggccgacggtcgctacggcgagaaccccaac
cgcctgcagcactactaccagttccaggtggtcctgaaacccaacccggacgacatccag
gatctctacctggaatccctgcggcgcatcggcatcgacacccacgtgcacgacgtgcgc
ttcgtcgaggacaactgggagtcgccgaccctgggcgcctggggcctgggctgggaagtc
tggctgaacggcatggaagtcacccagttcacctacttccagcaggtcggcggcgtcgag
tgctacccggtcaccggcgagatcacctacggcctggagcgtctggccatgtacctgcag
ggcgtggattcggtgtacgacctggtgtggaccgacggcccgttcggcaaggtcacctac
ggcgacgtgttccaccagaacgaggtggagcagtccacctacaacttcgagcacgccaac
gtggccaagctgttcgagctgttcgacttctacgagtccgaggccaaccgcctgatcgcg
ctggagctgccgctgccgacctacgagatggtcctcaaggcctcgcacaccttcaacctg
ctggacgcccgccgcgccatctcggtgaccgagcgccagcgctacatcctgcgcgtgcgc
accctggcccgcgccgtggcgcagagctacctgctggcgcgcgccaagctcggcttcccg
atggccccccccgaactgcgtgacgaagtcctggccaagctggaggctgcagaatga

KEGG   Azotobacter chroococcum: Achr_1150
Entry
Achr_1150         CDS       T03640                                 
Symbol
glyS
Name
(GenBank) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_1150 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acx01007]
    Achr_1150 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acx03016]
    Achr_1150 (glyS)
Enzymes [BR:acx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Achr_1150 (glyS)
Amino acid related enzymes [BR:acx01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Achr_1150 (glyS)
Transfer RNA biogenesis [BR:acx03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Achr_1150 (glyS)
SSDB
Motif
Pfam: tRNA_synt_2f DALR_1 Esterase_PHB
Other DBs
NCBI-ProteinID: AJE19629
UniProt: A0A0C4WIS2
LinkDB
Position
130125..132182
AA seq 685 aa
MSAQDFLVELGSEELPPKALKNLAAAFLAGIEKGLASAGLDYRVARVYAAPRRLAVLVEQ
LSTQQPDRTQNLDGPPLAAAFDAEGNPTQAALGFARKCGVELSEIDSSGAKLRYSRQIPG
QPAAALLPAIVQASLDELPIPKRMRWGARKDEFVRPSQWLVMLLGNQVVDCEILAQKAGR
ESMGHRFHHPDAVRISQPSSYLEDLRSAYVLADFAERRELIAGCVAELAAQQQGSAIVPE
ELLDEVTALVEWPVPLVCSFEERFLAVPQEALISTMQDNQKYFCLLDANGKLLPRFITVA
NIESKDPAQIVAGNEKVVRPRLTDAEFFFNQDKRQSLESFNQRLASVVFQAQLGSVLDKA
ERVSRLAGFIAERIGGNPEHAIRAGILSKSDLASEMVSEFPELQGIAGYHYALNDGEPED
VARALDEQYMPRGAGARLPSTLTGAAVAMADKLDTLVGIFGIGMPPTGSKDPYALRRAAL
GILRILIEKQLDLNLEEASHFAVAQYGAKVKAAGLAEQVSEFVFDRLRARYEDEGIDVSS
YLAVRALQPASAYDLDLRVQAVQAFRRLPEAEALAAVNKRVSNLLGKYEGKLPATIEARY
FDNACEFSLYSALQQAQHAVRPLAAERRYREALERLASLRDPVDAYFEAVLVNAEDPAIR
ANRHAMLAQLRGLFLCVADISVLGQ
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgagtgcacaagatttcctggtcgaactgggcagcgaagagctgccgccgaaagccctg
aagaacctcgccgccgccttcctcgccggcatcgagaaggggctggccagcgccggcctc
gactaccgggtcgcccgcgtctacgccgcgccgcgccgcctggcggtgctggtcgagcaa
ctgtccacccagcagccggaccgcacccagaacctcgacggcccgccgctggcggccgcc
ttcgacgccgagggcaatccgacccaggccgccctcggcttcgcccgcaagtgcggcgtc
gagctgagcgagattgacagcagcggcgccaagctgcgctacagccgccagattcccggc
cagccggccgccgcgctgctgccggcgatcgtccaggcctcgctcgacgagctgccgatt
cccaagcgcatgcgctggggcgcgcgcaaggacgagttcgtccgcccgagccagtggctg
gtgatgctgctcggcaaccaggtggtcgactgcgagatcctcgcccagaaggccggccgc
gaatccatgggccaccgcttccaccacccggacgcggtgcgcatcagccagccgtccagc
tacctggaagacctgcgcagcgcctacgtgctggccgacttcgccgagcgccgcgagctg
atcgccggctgcgtcgccgaactggccgcgcagcagcagggcagcgccatcgtgcccgag
gagctgctcgacgaggtgaccgcgctggtcgagtggccggtgccgctggtctgctccttc
gaggaacgcttcctcgccgtgccccaggaagcgctgatctccaccatgcaggacaaccag
aagtacttctgcctgctggatgccaatggcaagctgctgccgcgcttcatcaccgtggcc
aacatcgagagcaaggacccggcgcagatcgtcgccggcaacgagaaggtggtacgcccg
cgcctcaccgacgccgagttcttcttcaaccaggacaagcggcagagtctggaaagcttc
aaccagcgcctggccagcgtggtcttccaggcccagctgggcagcgtgctggacaaggcc
gagcgcgtctcgcggctggccggtttcatcgccgaacgcatcggcggcaatccggagcac
gccatccgtgccggcatcctgtcgaagagcgacctggccagcgagatggtcagcgaattc
cccgagctgcagggcatcgccggctaccactacgcgctcaacgacggcgagccggaagac
gtcgcccgcgccctcgacgagcagtacatgccgcgcggcgccggcgcccggctgccgtcg
acgctgaccggcgccgcagtggcgatggccgacaagctcgacaccctggtcggcatcttc
ggcatcggcatgccgcccaccggcagcaaggacccctatgccctgcgccgggccgccctg
ggcatcctgcgcatcctcatcgagaagcagctggacctgaacctcgaggaggccagccac
ttcgcggtcgcccagtacggcgccaaggtcaaggccgccggcctcgccgagcaggtcagc
gagttcgtcttcgaccgcctgcgcgcgcgctacgaggacgagggcatcgacgtctccagc
tacctggcggtgcgtgccctgcagccggcctcggcctacgacctggacctgcgcgtgcag
gcggtgcaggccttccgccggctgccggaagccgaggcgctggccgcggtgaacaagcgc
gtctccaacctgctcggcaagtacgagggcaagctgccggcgaccatcgaggcccgctac
ttcgacaacgcctgcgagttctccctgtactcggcgctgcagcaggcccagcacgcggtc
cggccgctggccgccgagcgccgctaccgcgaggcgctggagcgcctggccagcctgcgc
gatccggtggacgcctacttcgaggcggtgctggtcaacgccgaggacccggcgatccgc
gccaaccgccacgccatgctggcgcagctgcgcggcctgttcctctgcgtcgccgacatc
tccgtgctgggacagtga

DBGET integrated database retrieval system