KEGG   Azotobacter chroococcum: Achr_12220
Entry
Achr_12220        CDS       T03640                                 
Name
(GenBank) Periplasmic binding protein/LacI transcriptional regulator
  KO
K10439  ribose transport system substrate-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_12220
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Achr_12220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_12220
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Achr_12220
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 AAA_25
Other DBs
NCBI-ProteinID: AJE20701
UniProt: A0A0C4WKT4
LinkDB
Position
complement(1349547..1350569)
AA seq 340 aa
MKRRLFFRFLSAATLLCGLPFGLLAGAEPLQFALIAKRVDHPFFIQAGEGCAEAAQAQND
TCLLLGASELEHFRLQNQALEQALNMDLDGIALSVTHSKWLADHALQRASKTPLITFEAD
LKPAERHLRRGYVGLDNLAFGQQLGVLAKRFRPQGGKLCVLNGSARETNYQERLQGIRQQ
LRGSQTQTKVRAADRLRGENGWSEPNRCPLYRAENPEKAVLQLAALLKASEVDVIISTGS
WPIYQADVFRQQLGPLLAELDKKGARPAIIIATNEPDAVQRALLDDGLVQAYLSLEGREI
GRQSYRMLKRLAQGEPVPEKIFVDSHIYLPKASTDIPSEP
NT seq 1023 nt   +upstreamnt  +downstreamnt
ttgaaaagacgtctatttttccgctttctttccgctgccaccctgctctgcgggctgccg
ttcggcctcctcgccggcgccgaaccgttacagttcgcgctgatcgccaagcgggtcgac
catcccttcttcatccaagccggcgaaggctgtgccgaggccgcccaggcccagaacgat
acctgtctgttgctgggcgcctcggagctagagcattttcgcctgcaaaatcaagcactg
gagcaagccctcaacatggacctggacggtattgccctgtcagtgacccattcgaaatgg
ctggccgatcatgccttgcagcgggcgagcaagacgccgctgatcaccttcgaggcggac
ttgaaaccggcagagcggcatctgcgcagaggctatgtcgggctcgacaacctggctttt
ggccaacaattgggcgtactcgccaagcgcttcaggccacagggcggaaagctatgcgtc
ttgaacggcagcgcgcgggaaaccaactaccaggaacgcctccagggcatccgccaacaa
ctgcgtggcagccaaacccaaaccaaggttagggcagctgaccggctgaggggggagaat
ggctggagcgagccgaaccgttgcccgctctatcgcgccgaaaacccagagaaggcggtg
ctccagcttgccgccttgctgaaggcaagcgaggttgacgtcattatcagtaccggcagt
tggccgatttaccaagccgatgtatttcgccagcagctcggcccgttgctcgccgaactc
gacaaaaaaggcgcgcgcccggccatcatcatcgctacgaatgagcccgacgcagtgcag
cgcgcgctgctcgacgacggcctggtacaggcctatttgagcctggaaggccgcgagatc
ggccgccaaagttaccggatgctcaagcgtctagcccaaggagagcctgttcccgagaag
attttcgtcgacagccacatctatctgcctaaagcatcaacggacattccttcggagcct
taa

KEGG   Azotobacter chroococcum: Achr_12510
Entry
Achr_12510        CDS       T03640                                 
Name
(GenBank) Periplasmic binding protein/LacI transcriptional regulator
  KO
K10439  ribose transport system substrate-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_12510
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Achr_12510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_12510
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Achr_12510
SSDB
Motif
Pfam: Peripla_BP_4
Other DBs
NCBI-ProteinID: AJE20729
UniProt: A0A0C4WKL7
LinkDB
Position
complement(1383948..1384964)
AA seq 338 aa
MKKPPSFCFHSTATLLCGLLLILPAGAEPLQFALVAKRVDQRFFILAGEGCAEAAQAQGD
TCLLLGASGPAHFRQQNKALEQALERDLDGIALAVTHSKWLAEHALQRTDKTPLITFDAD
LAPAEQHLRRGYVGIDNLAFGRQLGMLAQRLRPQGGKLCVLTGDLQDIYQQERLQGIRQQ
LGGIPSHQGVDRLSGEKGWSEPHRCPLKRAETPESALLQLATLLNTRHFDAIISLGSWPV
HHADSYRRQIGPLLTELDAKHSHPAIIIASSEPDAAQRALLNDGLVQAYLDMNSREIGRQ
SYWMLKRLARGEPTAETLLVDSYIVYLPKSPPGMTATP
NT seq 1017 nt   +upstreamnt  +downstreamnt
ttgaaaaagccgccctctttctgcttccactccacagccaccctgctctgcgggctgctg
ctcatcctccctgcgggtgccgaaccgctgcagtttgcgctggtcgccaagcgcgtcgat
cagcgcttcttcatcctcgccggtgaaggctgtgccgaggccgcccaggctcagggcgat
acctgcctgttgctgggcgcctcggggccggcgcattttcgccagcagaacaaagccctg
gagcaggctctcgaaagggatctggacggtatcgccctggcggtgacccattcgaaatgg
ctggccgagcatgccctgcaacggacagacaagacaccgctgattaccttcgatgcggac
ttggcccccgcagagcagcacctgcgcagaggctacgtcgggatcgacaacctggcgttc
ggccgccaactgggcatgctcgcccagcgcctcagaccacagggcggcaaactgtgtgtc
ttgaccggcgacctgcaagacatctaccagcaggaacgcctgcaaggcatccgccagcag
ctcggcggcatcccgagccaccagggagtcgaccgactgagcggggagaagggctggagc
gagccgcaccgttgtccgctgaaacgcgccgagacgccggaaagcgcattgctccagctc
gccaccctgctgaacactcgccacttcgatgccatcatcagcctcggtagctggccggtt
catcatgccgatagctaccgtcgacaaatcggcccgctgctcaccgagctcgatgccaaa
cacagtcatccggccatcatcatcgcctcgagcgagccggacgcggcacagcgcgccttg
ctcaatgacggcctggtacaggcctatctggacatgaatagccgcgagatcggccgccag
agctactggatgctcaagcgtctggcacggggcgaacccactgccgagacccttctcgtc
gacagctacatcgtctatctgcccaaatcgccgccaggcatgaccgcaacgccttga

KEGG   Azotobacter chroococcum: Achr_27480
Entry
Achr_27480        CDS       T03640                                 
Name
(GenBank) periplasmic sugar-binding protein
  KO
K10439  ribose transport system substrate-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_27480
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Achr_27480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_27480
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Achr_27480
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1
Other DBs
NCBI-ProteinID: AJE22171
UniProt: A0A0C4WNP0
LinkDB
Position
3105217..3106227
AA seq 336 aa
MNTLSLARFLATVALLCGVFGSLPGAAEPLQFALLAKRVDHPFFIVALEGCTEAAQAQGA
TCLLLGPAGSRHFRQQNEALERALDRDFDGIALSVTHSRWLAEHALQRLGQTPLITFDSD
LSPAEQHLRRGYVGLDNLAFGRQLGRLAQRFRPHGGRLCILSASPQDTNLRERLQGIRQQ
LRGLGPAEVERLDGENGWSELKRCPLYSGGDQQSALFQLTTLLNSGQADTIVSLGGWPVH
RADEFRRQLGPLLATLDARGARPVIIFPTIELDGAQRALLDEGLVQAFLSMETREIGRQS
YRMLKRLAQGLPIPEKTLVDSHAYLPEAPVQNQAPP
NT seq 1011 nt   +upstreamnt  +downstreamnt
gtgaacactctgagccttgcccggtttcttgccactgtcgctttgctctgtggagtgttc
ggctcccttcccggcgcagccgagcccttgcagttcgcattgctcgccaagcgggtcgac
catccctttttcatcgtggccctcgaaggttgcaccgaagccgcccaggcccaaggcgct
acctgcctgttgctcggccctgcggggtcgcgtcatttccgtcagcagaacgaagccctc
gaacgggcactcgaccgggacttcgatggcatcgccctgtcggtcacccattcgcggtgg
ctggccgagcacgccttgcagcgcctgggccagacaccgctgatcaccttcgactcggac
ctgagccccgccgaacagcatctgcgccgcggctatgtcgggctcgacaacctggccttc
ggccggcagctgggtcggctcgcccagcgttttcggccgcacggcggcaggctgtgcatc
ctgagcgccagtccgcaggacaccaacctccgggaacgcctgcagggcatccgccagcaa
ctccgcggcctcggacccgccgaagtcgaacggctggacggagagaatggctggagcgaa
ttgaaacgctgcccgctctacagcggcggcgatcagcagagcgctctgttccagctcacc
accctgctgaactccggtcaggccgacaccatcgtcagcctcggcggctggccggtacac
cgggccgacgagttccgccggcagctcggcccgctgctcgccacactcgacgccaggggc
gcacgcccggtcatcatcttccccaccatcgaactcgacggcgcgcagcgcgccctgctc
gacgagggcctggtgcaggccttcctgagcatggaaacccgcgagatcggccggcagagc
taccggatgctgaagcgcctggcgcagggcctgcccatccccgagaaaacgctcgtcgac
agccatgcctacctgcccgaagcgccggtgcagaaccaggcgcccccctga

KEGG   Azotobacter chroococcum: Achr_3010
Entry
Achr_3010         CDS       T03640                                 
Name
(GenBank) Sugar ABC transporter periplasmic sugar-binding protein
  KO
K10439  ribose transport system substrate-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_3010
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Achr_3010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_3010
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Achr_3010
SSDB
Motif
Pfam: Peripla_BP_4 Glyco_trans_4_4
Other DBs
NCBI-ProteinID: AJE19807
UniProt: A0A0C4WNZ2
LinkDB
Position
complement(322258..323319)
AA seq 353 aa
MKGSFALRFLPIAGLLCGSLLAPPAGAEALRFALVAKRMDQSFYALAGEGCAEAAQAEGD
TCLLLGPLGRQHFRRQNEVLSQALARDDLHGIGLAVSHSGWLAEHALKGAGRIPLIAFNS
DLAPAEQHLRRSYVGLDNLRFGRQLAMLAQRFRPQGGKLCILSGGIQNTNHLERIQGIRR
QLRGNPAEDGATGRLKGENGWSEASRCPLYDNSDPASARLRLATLLATGSQLDVIVVLGI
WPIYEADEYRRQIGPLLAALDRQGRRPAIIVTTHEMDAAQRALLDDGLAQAYLNMESREI
GRQSYRMLKRLAQGEPVPEKVFVASHVYLPGVPPTVAPTPPPPGAPAETRSAP
NT seq 1062 nt   +upstreamnt  +downstreamnt
gtgaaaggatcgttcgcgttgcgctttcttccgatagccggcctgctgtgcgggtcgctg
ctcgcccctccggccggagccgaggcgttgcgcttcgccctggtcgccaagcggatggac
cagtccttctacgcgctggccggcgagggctgcgccgaggccgcgcaggccgagggcgac
acctgcctgctgctcggcccgctgggaaggcagcatttccgccggcagaacgaagtcctg
agccaggccctcgcccgggacgatctgcacggcatcggcctggcggtcagccactccggc
tggctggccgagcacgccctgaaaggcgcgggcagaatcccgctgatcgccttcaactcg
gacctggcccccgcggaacagcacctgcgccggagctacgtcgggctcgacaacctgcgc
ttcggccggcagctggccatgctcgcccagcgcttcaggccgcagggcggcaagctgtgc
atcctgagcggcggcatccagaacaccaaccacctggagcgtatccagggcatccgccgg
cagctgcgcggcaacccggccgaggatggtgcgaccggccggctgaagggcgagaacggc
tggagcgaagcgagccgctgccccctctacgacaacagcgatccggccagcgcgcggctc
aggctcgccaccctgctggccaccggcagccagctggatgtcatcgtcgtcctcggcatc
tggccgatttacgaggcggacgagtaccgcaggcagatcggcccgctgctcgccgcactc
gacagacagggccggcgcccggcgatcatcgtcaccacccacgaaatggacgcggcgcag
cgggcgctgctcgacgacgggctggcccaggcctatctgaacatggagagccgggagatc
ggccggcagagctaccggatgctcaagcgcctggcgcagggcgagcccgttcccgagaag
gtcttcgtcgccagccacgtctacctgcccggcgtgccgccgaccgttgcccctacgcct
cctccgcccggcgcaccggcggaaactcgatccgcaccctga

KEGG   Azotobacter chroococcum: Achr_37810
Entry
Achr_37810        CDS       T03640                                 
Name
(GenBank) periplasmic sugar binding protein
  KO
K10439  ribose transport system substrate-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_37810
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Achr_37810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_37810
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Achr_37810
SSDB
Motif
Pfam: Peripla_BP_4 MoCF_biosynth
Other DBs
NCBI-ProteinID: AJE23168
UniProt: A0A0C4WKB4
LinkDB
Position
4201851..4202801
AA seq 316 aa
MLLAPLASAEALQFALLAKRTDQHFFLEVGQGCAEAAAAEGDTCLLLGATGPAHFRRQNE
ALEQALGRGLDGIALSVTHSRWLAEHALKHLGRTPLITFDSDLAPAERHLRRGYVGIDNL
AFGRQLGLLVQRFRPQGGRLCILNSSQQDPNLRERLAGIRQQLRGVQGADGAERLAGENG
WREVKRCPLYTADNQENALRQLATLLQATELDAIVAVGSWPIYDAEAFRRQLGPLLAELD
ARGRRPAIVMTADEPDARQLALLDDGLVQAYVGAKSREIGRQSYHMLKRLAQGQPVAGQV
LVDSQVYLPDTAPAEP
NT seq 951 nt   +upstreamnt  +downstreamnt
ttgctgctcgctcccctcgccagcgccgaggccctgcagttcgcgctgctcgccaagcgg
accgatcagcatttcttcctcgaggtcggccagggctgcgccgaagccgccgcggccgag
ggcgatacctgtctgttgctgggcgccactggcccggcgcatttccgccggcagaacgag
gccctggagcaggccctcggccgcggcctggacggcatcgccctgtcggtgacccattcc
cgctggctggccgagcacgcgctcaagcacctgggccggacgccgctgatcaccttcgac
tcggacctggcgccggccgagcggcatctgcgccgcggctacgtcggcatcgacaacctg
gccttcggccggcagctcggcctgctcgtccagcgcttcagaccacagggcggcaggctg
tgcatcctcaacagcagccagcaggaccccaacctgcgcgagcgcctggccggcatccgc
cagcagctgcgcggcgtccagggcgcggacggcgccgaacggctggccggcgagaatggc
tggcgcgaagtgaaacgctgtccgctgtacaccgccgacaatcaggagaacgccctgcgc
cagctcgccaccctgctgcaggccacggagctcgatgcgatcgtcgccgtcggcagctgg
ccgatctacgacgccgaagccttccgccggcaactcggcccgctgctcgccgaactcgac
gccaggggcaggcgcccggccatcgtcatgaccgccgacgagcccgacgcgcgccagctc
gcgctgctcgacgacggcctggtgcaggcctatgtgggggcgaagagccgcgagatcggc
cggcagagctaccacatgctcaagcgtctggcgcaaggccagcccgtcgccgggcaggtc
ctcgtcgacagccaggtctacctgcccgacactgcgccggcagagccctga

KEGG   Azotobacter chroococcum: Achr_9860
Entry
Achr_9860         CDS       T03640                                 
Name
(GenBank) Periplasmic binding protein/LacI transcriptional regulator
  KO
K10439  ribose transport system substrate-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_9860
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Achr_9860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_9860
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Achr_9860
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1
Other DBs
NCBI-ProteinID: AJE20468
UniProt: A0A0C4WGY2
LinkDB
Position
1088639..1089655
AA seq 338 aa
MKILRSSRFIAAGLLCGLLVTPLASADPLQFALVAKRIDHDFFISAAKGCAEAAQAQGDT
CLLLGASGASHFRRQNEALEQALARGLDGIALSVTHSKWLANHALKRANKTPLITFDSDL
EPAEQHLRRGYVGLDNLAFGRQLGMLAQRLRPQGGKLCVLSGSSRDTNHRERLRGIRQQL
RGDQAESRAADRLNGQNDWSEPNRCPLYDTDNQESALLKLTTLLNSTNQYDTIISLGSWP
VHHADIYRRQLGPLLARLKAKGTSPTIIIAIPEFDTALRPLLEDGLVQAYLSMESREIGR
QSYRLLKSLVRGEPIPERIFVDSHAYLSEVPSDIPTER
NT seq 1017 nt   +upstreamnt  +downstreamnt
ttgaaaatattacgatcttctcgttttattgcggcgggcctgctctgcgggttgctggtc
actccccttgctagcgctgaccccttgcagttcgcattggtcgccaagcggatcgatcat
gatttcttcatctcggccgccaagggctgcgctgaggctgcccaggcccagggcgatacc
tgcctgttgttgggtgcttcgggggcgtcgcattttcgccggcaaaatgaagccctggaa
caggctctcgctagaggtctggatggtatcgccctgtcggtgacccattcaaagtggctg
gccaatcacgccctgaaaagggcaaacaagacaccactgatcactttcgattcggatttg
gaacccgcagagcagcatctgcgcaggggatacgtcggactcgacaatctggctttcggc
cggcaactgggcatgctcgcccaacgcctcaggccacaaggcggaaagctgtgcgtcctg
agtggtagctcgcgggacaccaaccatcgggagcgtctgcgaggcattcgccagcagttg
cgcggtgaccaagccgagagtagagcagccgaccggctgaacggacagaatgactggagc
gagccgaatcgctgcccgttatatgacaccgataatcaagagagcgcgttactcaagctc
accaccctgctgaactccaccaaccagtacgacaccatcatcagccttggcagttggccg
gttcatcacgccgatatctatcgccggcaactcggcccactacttgccagactcaaggca
aagggtacgtccccgaccatcatcatcgctattcccgagttcgacacagcgctgcgcccg
ctgcttgaagatggcctagtacaggcctatctgagcatggagagccgcgaaatcggtcgc
cagagctatcggctactgaagagcttggtgcgaggcgagcccattccggagaggattttc
gtcgatagccacgcctacctatccgaggtgccgtcggatattcccacggagcgttga

DBGET integrated database retrieval system