KEGG   Azotobacter chroococcum: Achr_14410
Entry
Achr_14410        CDS       T03640                                 
Name
(GenBank) Response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
  KO
K07666  two-component system, OmpR family, response regulator QseB
Organism
acx  Azotobacter chroococcum
Pathway
acx02020  Two-component system
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Achr_14410
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_14410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:acx02022]
    Achr_14410
Two-component system [BR:acx02022]
 OmpR family
  QseC-QseB (quorum sensing)
   Achr_14410
SSDB
Motif
Pfam: Response_reg Trans_reg_C FleQ
Other DBs
NCBI-ProteinID: AJE20908
UniProt: A0A0C4WHE9
LinkDB
Position
1577572..1578231
AA seq 219 aa
MRILLVEDDAALGEGIRTALKPEGYTVDWLQDGAAALHALGCESFDLCVLDLGLPRLDGL
ELLRRLRAAGNPLPVLVLTARDATSERIAGLDAGADDYLVKPFDVAELKARLRALLRRSF
NRPQPVLEHRGICLDPQSQAVSYQGRDIALARKEFLLLHELLAQPGRVLTRDRLQQALYG
WDEEVESNALEVHVHHLRRKFFPELIRTVRGVGYMVDRP
NT seq 660 nt   +upstreamnt  +downstreamnt
atgcgcattctgctggtggaagacgatgcggcgctgggcgagggcatccgcaccgcgctc
aagcccgagggctacacggtcgactggctgcaggacggcgccgcggcgctgcatgcgctg
ggctgcgagagcttcgacctctgcgtgctcgatctcggcctgccgcggctggacgggctg
gagctgctgcggcgcctgcgcgccgcgggcaatccgctgccggtgctggtgctgaccgcg
cgcgacgcgaccagcgagcgcatcgccgggctggatgccggtgccgacgattatctggtc
aagccgttcgacgtcgccgagctgaaggcgcggctgcgcgcgctgctgcggcgcagcttc
aatcgcccgcagccggtcctggagcaccgcggtatctgcctagatccgcagagccaggcg
gtcagctaccaggggcgggacatcgccctggcgcgcaaggagttcctgctgctgcacgag
ctgctggcgcagccgggccgggtgctgacccgcgaccggctgcagcaggcgctctacggc
tgggacgaggaggtggaaagcaacgccctggaggtgcatgtccaccacctgcgccgcaag
ttcttccccgagctgatccgcacggtgcgtggcgtcggctacatggtggacaggccctga

DBGET integrated database retrieval system