KEGG   Azotobacter chroococcum: Achr_14420
Entry
Achr_14420        CDS       T03640                                 
Name
(GenBank) Integral membrane sensor signal transduction histidine kinase
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
acx  Azotobacter chroococcum
Pathway
acx02020  Two-component system
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Achr_14420
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_14420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acx01001]
    Achr_14420
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:acx02022]
    Achr_14420
Enzymes [BR:acx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Achr_14420
Protein kinases [BR:acx01001]
 Histidine kinases
  OmpR family
   Achr_14420
Two-component system [BR:acx02022]
 OmpR family
  QseC-QseB (quorum sensing)
   Achr_14420
SSDB
Motif
Pfam: HATPase_c HisKA 2CSK_N HATPase_c_2 HAMP
Other DBs
NCBI-ProteinID: AJE20909
UniProt: A0A0C4WKY5
LinkDB
Position
1578231..1579649
AA seq 472 aa
MRSIRARTLFLVLGVLTLSLSLISYKSYRDAQHEIEELFDAQLAQTARLLAGLVGREMLE
RERGELQAMLDEALAMQTLPGGHGALSLGHRYEGKLAFQVFDEQGQLLLHSASAAHTLFS
RLLAEVPAGLADERLIGYHLLELEPFRWRVFALHDRVDRRWILVGEREDVRGELAGKIAK
RSLMPDLFGLPLLALLVWLAIGCGLRPLERMVGLIRARDPNNLAPLLLAPLPRELEPVMA
ALNRLLLQLTQLLERERQLLAAAAHELRTPLAVLRIHAQNALEAPDPVDRDEALRQLGPG
VERATRVVGQLLALARLEPAAVQPNMASLDLAAFLRNELAELTPLALAREQELTLETSGA
GGYELRGDAPSLAILVQNLVANAVQYTPAGGCIRLLLEADADCLRLRVQDSGPGIAPELR
EKVFERFFRAGAGQGAGLGLSIVRRAVELHGGEIALGESPLGGLEVSVRLPR
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgcgctcgatccgtgcccgcaccctgttcctcgtcctcggtgtgctgaccctgtccctg
tcgctgatctcctacaagagctaccgggatgcccagcacgagatcgaggaactgttcgat
gcgcagctggcgcagaccgcccggctgctcgccggactggtcggtcgcgaaatgctcgag
cgcgagcgcggggagctgcaggccatgctcgacgaggcactggcgatgcagaccctgccg
ggcgggcacggggcgctgtcgctgggccatcgctacgaaggcaagctggccttccaggtg
ttcgacgagcagggccagctgctgctgcattcggcgagcgccgcgcacaccctgttttcc
agactgctggcggaggtgccggccggcctggccgacgagcggctgatcggctatcacctg
ctggagctggagccgttccgctggcgggtcttcgccctccacgaccgggtcgaccggcgc
tggatcctggttggcgagcgcgaggatgtgcgcggcgagctggcgggcaagatcgccaag
cgcagcctgatgccggacctgttcggcctgccgctgctggcgctgctggtctggctggcg
atcggctgcgggctgcgtccgctcgagcggatggtcgggctgatcagggcgcgcgatccg
aacaacctggcgccgctgctgctggcgcccctgccgcgggagctggagccggtgatggcg
gcgctcaaccgcctgctgctgcagctcacccagctgctggagcgcgagcgccagctgctc
gccgccgccgcccacgagctgcgcacgccgctggcggtgctgcgcatccatgcacagaac
gccctcgaggcgccggacccggtcgaccgcgacgaggcgctgcgccagctggggccgggc
gtcgagcgggcgacccgggtggtcgggcaactgctggcgctggcccgtctggagccggcg
gcggtgcagccgaacatggccagcctcgatctggccgccttcctgcgcaacgagctggcc
gagctgacgccgctggcgctggccagggagcaggagctgaccctggaaacctccggcgcg
ggcggctacgagctgcgcggcgatgcgcccagcctggcgatcctggtgcagaacctggtc
gccaacgccgtgcaatacaccccggcgggcggctgcatccggctgctgctcgaagctgat
gcggactgcctgcgcctgcgcgtgcaggacagcggcccggggattgcgccggaactgcgc
gagaaggtgttcgagcgcttcttccgcgccggcgcagggcagggcgccgggctcgggctg
tccatcgtgcgccgggcggtggagctgcacggcggcgagatcgccctcggcgagtcgccc
ctcggcgggctggaggtttccgttcgcctgccccgttag

DBGET integrated database retrieval system