KEGG   Azotobacter chroococcum: Achr_16080
Entry
Achr_16080        CDS       T03640                                 
Symbol
aroF
Name
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
acx  Azotobacter chroococcum
Pathway
acx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
acx01230  Biosynthesis of amino acids
acx02024  Quorum sensing
Module
acx_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Achr_16080 (aroF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_16080 (aroF)
Enzymes [BR:acx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Achr_16080 (aroF)
SSDB
Motif
Pfam: DAHP_synth_1
Other DBs
NCBI-ProteinID: AJE21066
UniProt: A0A0C4WLH6
LinkDB
Position
1771009..1772088
AA seq 359 aa
MNASVSAQLATSPLATAESVPARRSAQPLPSPAVLRQRLPLSPALAARVQADRAAIRAVL
DGHDPRLLVVVGPCSLHDPESARDYAARLAELAPQVGDQLLLVMRAYVEKPRTTVGWKGL
VYDPHLDGSGDMAEGLRLSRRLMLDILELGLPLANELLQPLAASYFDDLLGWAAIGARTS
ESQIHREMVSGLDLPVGFKNGTDGSLGIASDAMRSAAHAHRHFGIDELGHPALLQTRGNP
DTHLVLRGGHNGPNHDAASVAGARQALERQGITARIMVDCSHANSGKDPLRQPAVLDSVL
EQRLAGDASLRGVMLESHLFDGCQPLSGALRYGVSITDGCLGWNATERLLLDAARRLRG
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaatgcatccgtttccgcccagctcgccaccagccccctcgccaccgccgagtccgtt
cccgcccgccgcagcgcccagccgttgcccagccccgccgtgctgcgccagcgcctgccg
ctgagtcctgcgctcgccgcacgtgtccaggccgaccgcgccgccatccgcgccgtgctc
gacggtcacgacccgcgccttttggtggtggtaggcccctgttcgctgcacgaccccgaa
tccgcacgggactacgccgcgcgcctggccgagctggcgccgcaggtcggcgaccagttg
ctgctggtgatgcgcgcctacgtcgagaagccgcgcaccaccgtcggctggaaaggcctg
gtctacgatccgcacctggacggcagcggcgacatggccgagggcctgcgcctgtcgcgc
cggctgatgctggacattctcgagctgggtctgccgctggccaacgagctgctgcagccg
ctggcggccagctacttcgacgacctgctcggctgggcggccatcggcgcgcgcaccagc
gagtcgcagatccaccgcgaaatggtcagcggcctggacctgccggtgggcttcaagaac
ggcactgacggcagcctgggcattgccagcgacgccatgcgctcggccgcccatgcccac
cggcatttcggcatcgacgagctgggccatccggccctgctgcagacccgcggcaacccg
gacacccatctggtgctgcgcggcggccataacgggccgaaccacgatgcggccagcgtc
gccggcgcccgccaggcgctggagcgccagggcatcacggcgcggatcatggtcgactgc
agccacgccaacagcggcaaggacccgctgcgccagccggccgtgctggacagcgtgctc
gagcagcgcctggccggcgatgcgagcctgcgcggggtgatgctggagagccatctgttc
gacggctgccagccgctgtccggcgcgctgcgctacggcgtctcgatcaccgacggctgc
ctcggctggaacgccaccgaacggctgctgctggacgccgcccggcgcctgcgcggctga

KEGG   Azotobacter chroococcum: Achr_18800
Entry
Achr_18800        CDS       T03640                                 
Name
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
acx  Azotobacter chroococcum
Pathway
acx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
acx01230  Biosynthesis of amino acids
acx02024  Quorum sensing
Module
acx_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Achr_18800
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_18800
Enzymes [BR:acx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Achr_18800
SSDB
Motif
Pfam: DAHP_synth_2
Other DBs
NCBI-ProteinID: AJE21335
UniProt: A0A0C4WP53
LinkDB
Position
complement(2080350..2081753)
AA seq 467 aa
MKPNWTPDSWRTRPIQQQPEYPDTTHLAQVEATLAGYPPLVFAGEARELRRLFAEVSQGR
AFLLQGGDCAESFAEFSSSKIGDTVKVLLQMAVIMTFAAGCPVVKVGRMAGQFAKPRSAG
SETVDGVTLPAYRGDIVNGIDFDEKSRTPDPQRLLRAYHQSTATLNLLRAFAQGGFADLH
QLHQWNLDFISDETLSEKYSQLAGRIDESLAFIRACGLKSTPQLHKTSFFTAHEALLLNY
EQALTRQDSLTGEWYDCSAHMLWIGDRTRQPDGAHVEFLRGVGNPIGVKVGPSMDPDELL
RLIDSLNPDNDPGRLNLIARMGADRVEEHLPALIRAVRREGRQVLWSCDPMHGNTIKAGG
YKTRAFESILHEVRQFFAVHRAEGSHAGGIHIEMTGQNVTECIGGSRAVTEERLSDRYHT
HCDPRLNADQALELAFLIAESIKPEHSKAPRHSGTRSGHRYRLLEVR
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgaagccgaactggactcccgacagctggagaaccaggcccatacagcagcaacccgaa
taccccgataccacccatcttgcccaggtcgaagcaaccctggccggttatccgccgctg
gtgttcgccggcgaggcacgcgagctgcgccggctgttcgccgaagtcagccagggacgc
gcctttctgctgcagggaggcgattgtgcggagagcttcgccgaattctcctcgagcaag
atcggcgataccgtgaaagtgctgttgcagatggcggtgatcatgaccttcgccgccggc
tgcccggtggtcaaggtcggacgcatggccggccagttcgccaagccacgctcggcgggc
agcgaaaccgtcgacggcgtcaccctgcccgcctaccgcggcgacatcgtcaacggcatc
gacttcgacgagaaaagccggacaccagacccgcaacgcctgctgcgggcctatcaccag
tccaccgccaccctcaacctgctgcgcgccttcgcccagggcggcttcgccgacctgcat
caactccaccagtggaacctcgacttcatctctgacgaaaccctgtcggaaaagtacagc
cagctggccggccgcatcgacgaaagcctcgccttcatccgcgcctgcggtctgaagagc
acgccgcagttgcacaagaccagcttcttcaccgcccacgaggcgctgctcctgaactac
gagcaggccctcacccgccaggacagcctgaccggcgagtggtacgactgctcggcgcac
atgctgtggatcggcgaccgcacccgccagccggacggtgcccacgtggagttcctgcgc
ggcgtcggcaacccgatcggggtgaaggtcggccccagcatggacccggacgagctgctg
cgcctgatcgacagcctcaacccggacaacgacccggggcgcctcaacctgatcgcgcgg
atgggcgcggacagggtggaagagcatctgccggcgctgatccgcgcggtgcggcgcgag
ggccgccaggtgctgtggagctgcgatccgatgcacggcaacaccatcaaggcaggcggc
tacaagactcgcgccttcgagagcatcctgcatgaggtgcggcagttcttcgccgtgcac
cgggccgagggcagccatgccggcggcatccacatcgagatgaccgggcagaacgtcacc
gaatgcatcggcggcagccgtgcagtcaccgaagaacgactttccgatcgctatcacacc
cactgcgatccgcgcctgaatgccgaccaggctctggagctggcctttctgatcgccgaa
tcgatcaagcccgagcactcgaaggccccccggcacagcggcacgcgatcgggccacagg
tatcggctgctggaagttcgctga

KEGG   Azotobacter chroococcum: Achr_23420
Entry
Achr_23420        CDS       T03640                                 
Symbol
aroG
Name
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
acx  Azotobacter chroococcum
Pathway
acx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
acx01230  Biosynthesis of amino acids
acx02024  Quorum sensing
Module
acx_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Achr_23420 (aroG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_23420 (aroG)
Enzymes [BR:acx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Achr_23420 (aroG)
SSDB
Motif
Pfam: DAHP_synth_1
Other DBs
NCBI-ProteinID: AJE21780
UniProt: A0A0C4WQE6
LinkDB
Position
2617001..2618077
AA seq 358 aa
MADLPINDINIVSNDPLITPEQLKTEIPLSATAMDTVSRGREVIRNILDGKDHRLFVVVG
PCSIHDVKAAHEYAERLKTLAAEVSDTLFLVMRVYFEKPRTTVGWKGLINDPYLDDTFKI
QEGLHIARQLLLDVAEMGLPTAGEALDPISPQYLQDLFSWSAIGARTTESQTHRELASGL
SSAVGFKNGTDGSLTVAINALQSVSRPHRFLGINQQGSVSIVATKGNTYGHVVLRGGNGK
PNYDSVSVAICEQELSKAGILPNIMVDCSHANSNKDPALQPLVMANVANQILEGNSSIIG
LMVESNLGWGSQSIPANLDDLKYGVSVTDACIDWDATVTAVRDMHAKLKDVLPKRKRP
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggccgacttaccgatcaatgacattaatattgtctccaacgaccctctgatcaccccc
gagcagctcaagaccgaaatccccctgagcgccaccgccatggacaccgtctcccgcggt
cgcgaagtcatccgcaacattctcgacggcaaggaccatcgcctgttcgtggtagtcggt
ccgtgctccatccatgacgtcaaggccgcacatgagtacgcggagcggctgaagaccctc
gccgcagaggtttccgacaccctgttcctggtgatgcgcgtctacttcgagaaaccccgc
accaccgtcggctggaaaggtctgatcaacgacccctatctggatgacaccttcaagatc
caggaggggctgcacattgcacgccaactgctgctcgatgtcgcagaaatgggactgccg
accgccggcgaggccctggatccgatttccccgcagtacctgcaggacctgttcagctgg
tcggccatcggtgcccgcaccacggaatcccagacacaccgggagctggcttccggcctg
tcatctgccgtcggcttcaagaacggcacggacggcagcctgaccgtcgcgatcaacgca
ttgcagtcggtatccaggccccatcgcttcctcggcatcaaccagcagggcagcgtctcc
atcgttgccaccaagggcaacacctacggacatgtcgtgctgcgtggcggcaacggcaag
cccaactacgactcggtcagcgtcgccatctgcgagcaggaactgagcaaggccggcatc
ctgccgaacatcatggtggactgcagccatgccaattcgaacaaggatccagccctgcag
cccctggtcatggccaacgtcgccaaccagattctcgaagggaactcatccatcatcggc
ctgatggtggaaagcaacctgggctggggcagccagtcgattcccgccaacctggacgac
ctcaagtatggggtttccgtcaccgacgcctgcatcgactgggatgccacggtcacggcg
gtgcgggacatgcacgccaagctcaaggatgtgctgccgaaacgaaaacgcccttga

KEGG   Azotobacter chroococcum: Achr_27500
Entry
Achr_27500        CDS       T03640                                 
Name
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
acx  Azotobacter chroococcum
Pathway
acx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
acx01230  Biosynthesis of amino acids
acx02024  Quorum sensing
Module
acx_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Achr_27500
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_27500
Enzymes [BR:acx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Achr_27500
SSDB
Motif
Pfam: DAHP_synth_2
Other DBs
NCBI-ProteinID: AJE22173
UniProt: A0A0C4WIN0
LinkDB
Position
3107056..3108438
AA seq 460 aa
MHGHAKTSRSEQPMKQNWSPASWRAKPIQQQPEYPDAAHLAQVEETLAGYPPLVFAGEAR
ELRRLFGEVSQGRAFLLQGGDCAESFAEFSATKIRDTFKVLLQMAIAMTFAAGCPVVKVG
RMAGQFAKPRSAGSETVDGVTLPAYRGDIVNGIDFDAKSRVPDPQRLLQAYHQSTATLNL
LRAFAQGGFADLHQVHQWNLDFIADAALSEKYSQLADRIDETLAFMRACGLENAPQLHET
SFFTAHEALLLNYEQALTRQDSLTGEWYDCSAHMLWIGDRTRQPDGAHVEFLRGVGNPIG
VKVGPTTDPEGLLRLIDLLNPDNDPGRLNLIARMGADRVEEHLPALIRAVQREGRQVLWS
SDPMHGNTIKAGSYKTRAFESILREVRQFFAVHQAEGSHAGGIHIEMTGQNVTECIGGSR
AVTADSLSDRYHTQCDPRMNADQSLELAFLIAETLKQARR
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgcacggtcatgccaaaaccagccgatccgagcagccgatgaagcagaactggagtccc
gccagctggagggccaagcccatccagcagcaacccgaataccccgatgccgcccacctc
gcccaggtcgaggaaaccctggccggctatccgccgctggtcttcgccggcgaggcgcgc
gagctgcgccggctgttcggcgaggtcagccagggacgcgccttcctgctgcagggcggc
gattgcgcggagagcttcgccgagttctcggcgaccaagatccgcgacaccttcaaggtg
ctgctgcagatggcgatcgccatgaccttcgccgccggctgtccggtggtgaaggtcgga
cgcatggccggccagttcgccaagccgcgctcggcgggcagcgaaaccgtcgatggcgtt
accctgcccgcctaccgcggcgacatcgtcaacggcatcgacttcgacgcgaaaagccgg
gtgccggacccgcagcgcctgctgcaggcctatcaccagtccaccgccaccctcaacctg
ctgcgcgccttcgcccagggcggcttcgccgacctgcaccaggtccaccagtggaacctc
gacttcatcgccgacgcggcgctgtcggagaagtacagccagctggccgaccgcattgac
gagaccctcgccttcatgcgcgcctgcggcctggagaacgcgccgcagctgcacgagacc
agcttcttcaccgcccacgaagcgctgctgctgaactacgagcaggctctgacccgccag
gacagcctgaccggcgagtggtacgactgctcggcgcacatgctgtggatcggcgaccgc
acccgccagccggatggcgcccatgtggagttcctgcgcggcgtcggcaacccgatcggg
gtcaaggtcgggccgaccaccgaccccgaggggctgctccggctgatcgacctcctcaac
ccggacaacgatccggggcgcctcaacctgatcgcgcggatgggcgcggacagggtggaa
gagcatctgccggcgctgatccgcgcggtgcagcgcgagggccgccaggtgctctggagt
tccgacccgatgcacggcaacaccatcaaggccggcagctacaagacccgcgcgttcgag
agcatcctgcgcgaggtgcggcagttcttcgccgtgcaccaggccgagggcagccatgcc
ggcggcatccatatcgagatgaccgggcagaacgtcaccgaatgcatcggcggcagccgt
gcggtcaccgccgacagcctttccgatcgctaccacacccagtgcgacccgcggatgaac
gccgaccagtcgctggagctggccttcctcatcgccgagaccctgaaacaggcgcgccgc
tga

DBGET integrated database retrieval system