KEGG   Azotobacter chroococcum: Achr_17480
Entry
Achr_17480        CDS       T03640                                 
Name
(GenBank) high affinity branched chain amino acid ABC transporter, ATP binding component
  KO
K01996  branched-chain amino acid transport system ATP-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_17480
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_17480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_17480
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    Achr_17480
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 RsgA_GTPase AAA_16 AAA_25 MMR_HSR1 AAA_33 AAA_23 AAA_15 AAA_27 AAA_22
Other DBs
NCBI-ProteinID: AJE21204
UniProt: A0A0C4WLK7
LinkDB
Position
complement(1914168..1914869)
AA seq 233 aa
MLTFDNVSTCYGKIQALHGVSLEVREGEIVTLIGANGAGKSTLLMTLCGTPRASAGSIRY
RGEELVGQDTAAIMRKGIAVVPEGRRIFARLTVEENLAMGGFFASREEVEARLERVLELF
PRLAERYAQRGGTLSGGEQQMLAIGRALMGKPSLLLLDEPSLGLAPLVIRQIFAILEQLR
TEGVTVFLVEQNANQALKLADRGYVLENGRIVMHGSGEELLGDARVCEAYLGG
NT seq 702 nt   +upstreamnt  +downstreamnt
atgctgactttcgacaacgtctccacctgctacggcaagatccaggcgctccacggggtg
agcctggaggtgcgcgagggcgagatcgtcaccctgatcggcgccaacggcgccggcaag
tcgaccctgctgatgaccctctgcggcacgccgcgggccagcgccgggagcatccgctac
cgcggcgaggagctggtcggccaggacaccgccgcgatcatgcgcaagggcatcgccgtg
gtgccggaaggccggcgcatcttcgcccgcctgacggtcgaggagaacctcgccatgggc
ggcttcttcgccagccgggaggaagtcgaggcgcgcctggaacgggtgctggaactcttc
ccgcggcttgccgagcgctacgcccagcgcggcggcaccctctccggcggcgagcagcag
atgctcgccatcggccgcgcgctgatgggcaagcccagcctgctgctgctcgacgaaccc
tcgctgggcctggcgccgctggtcatccggcagatcttcgcgatcctcgagcaactgcgc
acggaaggcgtgacggtctttctggtcgagcagaacgccaaccaggcgctgaagctcgcc
gaccgcggctacgtgctggagaacgggcggatcgtcatgcacggcagcggcgaggagctg
ctcggcgatgcgcgggtgtgcgaggcctacctgggcggctga

KEGG   Azotobacter chroococcum: Achr_17490
Entry
Achr_17490        CDS       T03640                                 
Symbol
livG
Name
(GenBank) leucine/isoleucine/valine transporter ATP-binding subunit
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_17490 (livG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_17490 (livG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_17490 (livG)
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    Achr_17490 (livG)
SSDB
Motif
Pfam: ABC_tran BCA_ABC_TP_C AAA_21 AAA_23 AAA_22 AAA_29 AAA_30 Mg_chelatase SMC_N SRP54
Other DBs
NCBI-ProteinID: AJE21205
UniProt: A0A0C4WNU4
LinkDB
Position
complement(1914869..1915633)
AA seq 254 aa
MSALLEVRDLAMRFGGLLAVDGVSLSLGARQVLSMIGPNGAGKTTVFNCLTGFYRPSAGE
ILLDGEPIQGLPGHRITRKGIVRTFQNVRLFREMTALENLLVAQHRHLNTNFFAGLLKTP
AFRRSERQALEFAHQWLERVGLADCANRLAGTLAYGQQRRLEIARCMMTRPRLLMLDEPA
AGLNPRETEDLKALIGLLRDEHGLGVLLIEHDMPLVMGISDRIVVINQGRPLAEGTPAQI
RCHPEVIKAYLGEA
NT seq 765 nt   +upstreamnt  +downstreamnt
atgagcgccctgcttgaggtgcgcgacctggccatgcgcttcggcggcctgctggcggtc
gatggcgtgagcctgagtctcggcgcgcggcaggtgctgtcgatgatcggccccaacggc
gccggcaagaccacggtgttcaactgcctgaccggtttctaccggcccagcgccggcgag
atcctccttgacggcgagccgatccagggcctgccggggcaccggatcacccgcaagggg
atcgtgcgcaccttccagaacgtccgcctgttcagggagatgaccgcgctggagaacctg
ctggtggcccagcaccgccacctgaacaccaacttcttcgccggcctgctgaagaccccg
gccttccgccgcagcgaacgccaggcgctggaattcgcccaccagtggctggagcgggtc
gggctggcggactgcgccaaccgcctggccggcaccctcgcctatggccagcagcgccgc
ctggaaatcgcccgctgcatgatgacccgcccgcgcctgctgatgctcgacgagccggcc
gccggcctcaatccgcgggaaacggaggacctcaaggcgctgatcggcctgttgcgcgac
gagcacggtctcggcgtgctgctgatcgagcacgacatgccgctggtgatgggcatttcc
gaccggatcgtcgtcatcaaccagggccgcccgctggccgagggcacgccggcacagatc
cgctgccatcccgaggtaatcaaggcctatctgggagaagcctga

KEGG   Azotobacter chroococcum: Achr_17500
Entry
Achr_17500        CDS       T03640                                 
Symbol
livM
Name
(GenBank) leucine/isoleucine/valine transporter permease subunit
  KO
K01998  branched-chain amino acid transport system permease protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_17500 (livM)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_17500 (livM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_17500 (livM)
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    Achr_17500 (livM)
SSDB
Motif
Pfam: BPD_transp_2 DUF3382
Other DBs
NCBI-ProteinID: AJE21206
UniProt: A0A0C4WLU5
LinkDB
Position
complement(1915630..1916886)
AA seq 418 aa
MSTRLRTALFSALLVLAVAWPVLGLKLTTVGIRLEVHNASPAMLWSIAAAALGMFCWQLG
RDRLAALWSGAPSRPAVPGRVKEVLSLPATQRWGLLALLVPALVWPFFASRGAVDLATLI
LIYAMLGLGLNIVVGLAGLLDLGYVGFYAVGAYTYALLSEYWGLGFWTCLPIAGAMAALF
GLLLGFPVLRLRGDYLAIVTLGFGEIIRILLRNLTDITGGPNGIGGIDKPTLFGLTFERR
AAEGLQTFHGFFGLPYDSADKVIFLYLIALALVLLTLFVINRLLRMPIGRAWEALREDEI
ACRALGLNPTLIKLSAFTLGACFAGFAGSFFAARQGLVTPESFSFIESAVILAIVVLGGM
GSQLGVILAAVVMILLPELMREFSEYRMLLFGALLVLMMVWQPQGLLPMQRPHLELKS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgagcacccgattaaggaccgccctgttcagcgccctgctggtgctcgccgtggcctgg
ccggtgctcggcctcaagctgaccaccgtgggcatccgcctggaagtgcacaacgccagc
ccggcgatgctctggagcatcgccgccgcggctctcggcatgttctgctggcagctcggc
cgcgaccgcctcgccgccctctggagcggagcgccgtcgcggcccgccgtgccggggcgt
gtgaaggaggtcctcagcctgcccgcgacccagcgctggggcctgctcgccctgctggtg
ccggccctggtctggccgttcttcgcctcgcgcggcgcggtggacctggccaccctgatc
ctcatctacgccatgctcggcctcggcctgaacatcgtggtcggcctcgccggcctgctc
gatctcggctacgtcggcttctatgcggtcggcgcctacacctacgccctgctctcggag
tactggggcctgggcttctggacctgcctgccgatcgccggggcgatggccgcgctgttc
ggcttgctgctcggctttccggtgctgcgcctgcgcggcgactacctggccatcgtcacc
ctgggcttcggcgagatcatccgcatcctgctgcgcaacctcacggacatcaccggcggc
cccaacggcatcggcggcatcgacaagccgaccctcttcggcctgaccttcgagcgccgc
gccgcggagggcctgcagaccttccacggcttcttcggcctgccctacgactcggcggac
aaggtgatcttcctctacctgatcgccctggcgctggtgctgctcaccctgttcgtcatc
aaccgcctgctgcgcatgccgatcggccgcgcctgggaagccctgcgcgaggacgagatc
gcctgccgcgcgctgggcctcaatcccacgctcatcaagctctcggccttcaccctgggc
gcctgcttcgccgggttcgccggcagcttcttcgccgcccgccagggactggtgacgccg
gaatccttcagcttcatcgagtcggcggtgattctcgccatcgtcgtgctcggcggcatg
ggctcgcagctgggggtgatcctcgccgcggtggtgatgatcctgctccccgagctgatg
cgcgagttcagcgagtaccgcatgctgctgttcggcgccctgctggtgctgatgatggtc
tggcagccgcagggcctgctgcccatgcagcgcccgcacctggagctgaaatcatga

KEGG   Azotobacter chroococcum: Achr_17510
Entry
Achr_17510        CDS       T03640                                 
Symbol
livH
Name
(GenBank) high affinity branched chain amino acid ABC transporter, permease component
  KO
K01997  branched-chain amino acid transport system permease protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_17510 (livH)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_17510 (livH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_17510 (livH)
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    Achr_17510 (livH)
SSDB
Motif
Pfam: BPD_transp_2
Other DBs
NCBI-ProteinID: AJE21207
UniProt: A0A0C4WSF1
LinkDB
Position
complement(1916883..1917806)
AA seq 307 aa
MPELYHYLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIASYVAFIAIAGL
SMLGLEQLPLLMAAAFAASIVIASAYGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNE
VLLAQDSRDKAIPSLLPGNLVIGESAMHGVVISWTQILIFAVTLLVMLGLTLFISRSRLG
RACRACAEDLKMAGLLGIDTNRIIALTFVIGAVLAAVAAVLLGLQYGVINPQMGFLAGIK
AFTAAVLGGIGSIPGAMLGGLLLGVAEAFGADLFGDAYKDVVAFSLLVLVLLFRPTGILG
RPEVEKV
NT seq 924 nt   +upstreamnt  +downstreamnt
atgcccgagctctaccactacctgcaacagctggtgaacggcctgacggtcggcagcacc
tacgcgctgatcgccatcggctacaccatggtctacggcatcatcggcatgatcaacttc
gcccacggcgaggtgtacatgatcgcctcctacgtggccttcatcgccatcgccgggctg
tccatgctcggcctggagcagctgccgctgttgatggccgccgccttcgccgccagcatc
gtgatcgccagcgcctacggctactccatcgagcgcgtcgcctaccgtccgctgcgcggc
ggcaaccggctgatcccgctgatctcggcgatcggcatgtcgatcttcctgcagaacgag
gtgctgctcgcccaggacagccgcgacaaggcgatccccagcctgctgccgggcaacctg
gtgatcggcgagagcgccatgcacggcgtggtgatctcctggacgcagatcctgatcttc
gccgtcaccctgctggtgatgctcggcctgaccctgttcatctcccgctcgcgcctcggc
cgcgcctgccgcgcctgcgccgaggacctgaagatggccggcctgctcggcatcgacacc
aatcgaatcatcgccctgaccttcgtcatcggcgccgtgctggcggcagtggcggcggtg
ctgctgggcctgcagtacggggtgatcaacccgcagatgggctttctcgccgggatcaag
gcgttcaccgccgcggtgctcggcggcatcggcagcatccccggcgccatgctcggcggc
ctgctgctcggcgtcgccgaggccttcggcgccgacctgttcggcgatgcctacaaggac
gtggtggccttcagcctgctggtgctggtgctgctgttccgtcccaccggcatcctcggc
cgtccggaggtggagaaggtatga

KEGG   Azotobacter chroococcum: Achr_17520
Entry
Achr_17520        CDS       T03640                                 
Symbol
livK
Name
(GenBank) Branched-chain amino acid ABC transporter substrate-binding protein
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_17520 (livK)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_17520 (livK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_17520 (livK)
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    Achr_17520 (livK)
SSDB
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5 Fe-ADH PGM_PMM_I Anticodon_2
Other DBs
NCBI-ProteinID: AJE21208
UniProt: A0A0C4WHR6
LinkDB
Position
complement(1917944..1919065)
AA seq 373 aa
MHKATRHLSRLFAALALAGATFHAAAAEPVRIALAGPVTGPVAQYGDMQFIGAKLAIERI
NEAGGVNGQLLEGSVYDDACDPKQAVAVANKIVNDGIAFVVGHLCSSSTQPAADIYEDEG
VLMITPAATSPQITAQGYQLIFRTIGLDSLQGPTAGAFIAERIKPQRVAVLHDKQQYGEG
IATAVRKTLQERGVEVALFEGLNAGDKDFSAMIAKLKQAGVDFVYYGGYHPELGLLLRQS
AEKGLKVRFMGPEGVGNKELSAIAGPASEGLLLTLPRAFDRDPHNQVLVEAFKAKNQDPS
GPFVFPAYAAVQLIAQGIEKAGSSEPEAVAEALRGNTFDTVTGTLAFDDKGDLKDFGFEV
YEWHRDASKTRVE
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgcacaaggccacccgacatctctcccggctgttcgccgccctggcgctcgccggagcc
accttccacgcggccgccgccgagccggtccgcatcgccctggccggaccggtcaccggg
cccgtggcgcagtacggcgacatgcagttcatcggcgcgaaactggccatcgaacggatc
aacgaggccggcggagtgaacggccagctcctcgagggcagcgtctacgacgacgcctgc
gatcccaagcaggccgtcgcggtggccaacaagatcgtcaacgacggcatcgccttcgtc
gtcggccacctctgctccagctcgacccagcccgccgcggacatctacgaggacgagggc
gtgctgatgatcacccccgccgcgaccagcccgcagatcaccgcccagggttatcagctg
atcttccgcaccatcggcctggacagcctgcagggaccgaccgccggcgccttcatcgcc
gagcggatcaaaccgcagcgtgtcgccgtgctgcacgacaagcagcagtacggcgagggc
atcgccactgcggtcaggaagaccctgcaggagcgcggcgtcgaggtggcgctgttcgag
ggcctcaacgccggcgacaaggacttctcggcgatgatcgccaagctcaagcaggccggc
gtcgatttcgtctactacggcggctaccacccggagctcggcctgctgctgcgccagtcc
gcggagaagggcctgaaggtgcgcttcatgggaccggaaggggtcggcaacaaggagctt
tccgccatcgccggaccggcctccgaggggctgctgctcaccttgccgcgcgccttcgac
cgggacccgcacaatcaggtgctggtcgaggccttcaaggccaagaaccaggaccccagc
ggccccttcgtgtttcccgcctacgccgccgtgcagctgatcgcccagggcatcgaaaag
gccggcagcagcgagcccgaggcggtcgccgaagccctgcgcggcaacaccttcgacacg
gtgaccggcacgctcgccttcgacgacaagggcgatctgaaggacttcggcttcgaggtc
tacgagtggcaccgggacgcgagcaagacccgcgtcgagtag

KEGG   Azotobacter chroococcum: Achr_21410
Entry
Achr_21410        CDS       T03640                                 
Name
(GenBank) ABC transporter, ATP-binding protein
  KO
K01996  branched-chain amino acid transport system ATP-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_21410
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_21410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_21410
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    Achr_21410
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N BCA_ABC_TP_C RsgA_GTPase AAA_29 AAA_15 AAA_16 DUF2813 MMR_HSR1 AAA_25 SbcC_Walker_B AAA_23 Dynamin_N
Other DBs
NCBI-ProteinID: AJE21590
UniProt: A0A0C4WPW3
LinkDB
Position
complement(2382273..2382989)
AA seq 238 aa
MSVPLLEFRNVDLHYGPIQALRQVSLHVDEGETVSLIGANGAGKSSLLMSIFGQPRVSAG
QILYRGEDITRKSAHHVASGGVAQSPEGRRVFPDMSVEENLLMGTIPIGMAHADEDLRRM
FELFPRLEERRNQRAMTLSGGEQQMLAIARALMSRPRLLLLDEPSLGLAPIVVKQIFQIL
RELAAGGMTLFLVEQNANHALKLSDRGYVMVNGQIRLSGTGEELLGNPEVRSAYLGGH
NT seq 717 nt   +upstreamnt  +downstreamnt
atgagcgtgcccttgctggaattccgcaacgtcgacctgcactacgggccgatccaggcg
ctgcgccaggtcagcctgcacgtcgacgagggcgagacggtcagcctgatcggcgccaac
ggcgcgggcaagtcgagccttttgatgtcgatcttcggccagccgcgggtgagcgccggg
cagatcctctaccgcggcgaggacatcacccgcaaatcggcccatcacgtcgcctccggc
ggcgtggcccagtcgccggaaggacgccgggtgttccccgacatgagcgtggaggagaac
ctgctgatgggcaccatcccgatcggcatggcgcacgccgacgaggacctgcggcgcatg
ttcgagctgttcccgcgcctcgaggagcggcgcaaccagcgcgccatgaccctctccggc
ggcgagcagcagatgctcgccatcgcccgcgcgctgatgagccggccgcgcctgctgctg
ctcgacgagccctcgctgggcctggcgcccatcgtggtcaagcagatcttccagatcctc
cgcgagctggcggccggcggcatgaccctgttcctggtcgagcagaacgccaaccatgcg
ctgaagctgtccgaccgcggctatgtgatggtcaacgggcagatccgcctgtcgggtacg
ggggaagagctgctgggcaacccggaagtgcgcagcgcctatctgggcgggcattga

KEGG   Azotobacter chroococcum: Achr_21420
Entry
Achr_21420        CDS       T03640                                 
Name
(GenBank) High affinity branched-chain amino acid ABC transporter, ATP-binding protein LivG
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_21420
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_21420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_21420
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    Achr_21420
SSDB
Motif
Pfam: ABC_tran BCA_ABC_TP_C AAA_21 AAA_23 SMC_N AAA_30 AAA_25 AAA_22 AAA_29 RsgA_GTPase AAA_15 AAA_27 AAA_16 FeoB_N SRP54 MMR_HSR1
Other DBs
NCBI-ProteinID: AJE21591
UniProt: A0A0C4WMK1
LinkDB
Position
complement(2382986..2383861)
AA seq 291 aa
MSGDEILRVEHLSMQFGGIRALHDVSLGVRRHSITALIGPNGAGKTTVFNCLTGFYRATG
GRIRLHARGRSTDVLQVLGEPFRAGDFVNPRRFASRLRYKLFGGTHLVNRAGLARTFQNI
RLFREMSVLENLLVAQHLWVERNLLAGILNTRGFQRAEEQALEHAFYWLEVVDLADCANR
LAGELSYGQQRRLEIARAMCTRPQLLCLDEPAAGLNPAETAALSRIIRTLRDAHEVTVLL
IEHDMGLVMGISDHILVLDHGELIAEGPPAAIRHDPRVIAAYLGADEEELA
NT seq 876 nt   +upstreamnt  +downstreamnt
atgagcggcgacgagattctccgcgtcgagcacctgtccatgcagttcggcggcatccgc
gcgctgcacgacgtcagcctgggcgtcaggcgccactccatcaccgcgctgatcggtccc
aacggcgccggcaagaccacggtgttcaactgcctgaccggcttctaccgcgccaccggc
gggcgcatccgcctgcatgcccgcggtcgcagcaccgacgtgctgcaggtgctcggcgag
ccgttccgtgcgggcgacttcgtcaacccgcggcgcttcgccagccgcctgcgctacaag
ctgttcggcggcacccacctggtcaaccgcgccgggctggcgcggaccttccagaacatc
cggctgttccgcgagatgtcggtgctggagaacctgctggtggcccagcacctgtgggtc
gagcgcaacctgctggccggcatcctcaacacccggggcttccagcgggccgaagagcag
gcgctggagcacgccttctactggctggaggtggtcgatctggccgactgcgccaaccgc
ctggccggcgagctgtcctacggccagcagcgccgcctggagatcgcccgggccatgtgc
acccggccgcagctcctctgcctggacgagccggccgccggcctcaacccggccgagacc
gccgcgctcagccgcataatccgcaccctgcgcgacgcgcacgaagtcaccgtgctgctg
atcgagcacgacatgggcctggtgatgggcatttccgaccacatcctggtgctcgaccac
ggcgagctgatcgccgaaggtccgcccgcggcgatccgccacgatcccagggtgatcgcc
gcctacctgggcgccgacgaggaggagctggcatga

KEGG   Azotobacter chroococcum: Achr_21430
Entry
Achr_21430        CDS       T03640                                 
Name
(GenBank) Branched-chain amino acid ABC transporter permease
  KO
K01998  branched-chain amino acid transport system permease protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_21430
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_21430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_21430
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    Achr_21430
SSDB
Motif
Pfam: BPD_transp_2 DUF3382 YqjK
Other DBs
NCBI-ProteinID: AJE21592
UniProt: A0A0C4WTI3
LinkDB
Position
complement(2383858..2385141)
AA seq 427 aa
MNMPERSSLDIRQPLLDSVLAGLIALVVFGPIVGVVLDGYGFNLQPARVAWIVGTVMLGR
FLLSLFLHSASGRGWMQRFEGSGAGVQVLAPDYRSHLRWIVPLVLLAALIFPFFASKYLL
TVIILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYEYLGLGFWSVLPLAA
LAAALAGALLGFPVLRMHGDYLAIVTLGFGEIIRLVLNNWLSLTGGPNGMSVPAPTFLGL
EFGRRAKDGGVPFHEFFGIAYDPNVKFLFIYAVLLLTVLLVLYVKGRLIRMPIGRAWEAL
REDEIACRAMGLNHVLVKLSAFMLGASTAGLAGVFFASYQGFVNPTSFTFFESALILAIV
VLGGMGSTLGVVLAAFVLTVAPELLRSFADYRVLLFGMLMVLMMIWRPRGLIRISRRGFA
PRPGVAP
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaacatgcccgagcgttcttccctggatatccgccagccgctgctcgacagcgtgctc
gccgggctgatcgccctggtggtgttcggccccatcgtcggcgtggtgctcgacggctac
ggcttcaacctgcaacccgcgcgcgtcgcctggatcgtcggcacggtgatgctcggccgc
ttccttctcagcctgttcctgcacagcgccagcggccgcggctggatgcagcgtttcgag
ggctccggcgccggcgtgcaggtgctggcgccggactaccgctcgcacctgcgctggatc
gtcccgctggtgctgctggcggcgctgatctttccgttcttcgccagcaagtacctgctc
accgtgatcatcctcggcctgatctacgtgctgctcggcctcggcctgaacatcgtggtc
ggcctcgccgggctgctcgacctgggctacgtggccttctatgcgatcggcgcctacggc
ctggcgctcggctacgaatacctcggcctcggcttctggagcgtgctgccgctggccgcg
ctcgccgcggcgctggccggggcgctgctcggctttccggtgctgcgcatgcacggcgat
tatctcgccatcgtcaccctgggcttcggcgagatcatccgcctggtgctgaacaactgg
ctgtccctcaccggcgggccgaacggcatgtcggtgccggcgccgaccttcctcggcctg
gagttcggccgccgggccaaggatggcggggtgccgttccacgagttcttcggcatcgcc
tacgaccccaacgtcaagttcctgttcatctacgcggtgctgctgctcaccgtgctgctg
gtcctttacgtcaagggccggctgatccgcatgccgatcggccgggcctgggaggcgctg
cgcgaggacgagatcgcctgccgcgccatgggcctcaaccacgtgctggtcaagctctcg
gcgttcatgctcggcgcttccacggcggggctggccggggtgttcttcgccagctaccag
ggcttcgtcaacccgacctcgttcaccttcttcgaatcggcgctgatcctcgccatcgtg
gtgctcggcggcatgggctcgaccctgggcgtggtgctcgccgccttcgtgctgacggtg
gcaccggagctgctgcgcagcttcgccgactaccgggtgctgctgttcggcatgctcatg
gtgctgatgatgatctggcggccgcgcgggctgatccgcatcagccgccgcggcttcgcg
ccgcgtccgggggtggcgccatga

KEGG   Azotobacter chroococcum: Achr_21440
Entry
Achr_21440        CDS       T03640                                 
Name
(GenBank) High-affinity branched-chain amino acid transport system permease protein LivH
  KO
K01997  branched-chain amino acid transport system permease protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_21440
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_21440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_21440
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    Achr_21440
SSDB
Motif
Pfam: BPD_transp_2 Trp_oprn_chp
Other DBs
NCBI-ProteinID: AJE21593
UniProt: A0A0C4WI62
LinkDB
Position
complement(2385138..2386052)
AA seq 304 aa
MDGIFLQQLINGLTLGSVYGLIAIGYTMVYGIIGMINFAHGEVYMISAYLSAIGLALLAF
FGLESFPLLIFGTLLFTVCVTGLYGWTIERIAYRPLRNSTRLAPLISAIGISLILQNYVQ
LSQGARQQGIPTLLDGAFRFHVGEGFLQISYTKVFILVAAFAGMAALTWVIHCTRLGRMC
RATQQDRKMAQILGIDTDRVISWVFVIGAAMAALAGLLITLNYGTFDFYAGFVIGIKAFT
AAVLGGIGSLPGAMLGGLILGVAEAQFSGMVNTDYKDVFSFSLLVLILIFRPQGLLGRPQ
VTKV
NT seq 915 nt   +upstreamnt  +downstreamnt
atggacggcatcttcctgcaacaactgatcaacggactgaccctcgggtcggtctacggt
ctgatcgccatcggctacaccatggtttacgggatcatcggcatgatcaacttcgcccac
ggcgaggtgtacatgatcagcgcctacctctcggccatcggcctggccctgctggcgttc
ttcggcctcgaatcctttccgctgctgatcttcggcacgctgctgttcaccgtctgcgtc
accggcctgtacggctggacgatcgagcgcatcgcctaccggccgctgcgcaactccacg
cgcctggcgccgctgatcagcgccatcggcatttcgctgatcctgcagaactacgtgcag
ctcagccagggcgcgcgccagcagggcataccgaccctgctcgacggcgccttccgcttc
cacgtcggcgagggctttttgcagatcagctacaccaaggtgttcatcctggtcgccgcc
ttcgccggcatggccgcgctgacctgggtgatccactgcacccggctcggccgcatgtgc
cgggccacccagcaggaccgcaagatggcgcagatcctcggcatcgacaccgaccgggtg
atctcctgggtgttcgtcatcggcgccgccatggccgcgctggccggcctgctgatcacc
ctgaactacggcaccttcgacttctacgccggcttcgtcatcggcatcaaggcgttcacc
gccgcggtgctcggcggcatcggctcgctgcccggcgccatgctcggcggcctgatcctc
ggggtcgccgaggcgcagttctccgggatggtcaacaccgactacaaggacgtgttcagc
ttctcgctgctggtgctgatcctgatcttccgaccgcaaggactcctgggccggccccag
gtgacgaaggtatga

KEGG   Azotobacter chroococcum: Achr_21450
Entry
Achr_21450        CDS       T03640                                 
Name
(GenBank) Amino acid ABC transporter substrate-binding protein
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_21450
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_21450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_21450
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    Achr_21450
SSDB
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5 Toprim_2
Other DBs
NCBI-ProteinID: AJE21594
UniProt: A0A0C4WMI6
LinkDB
Position
complement(2386219..2387334)
AA seq 371 aa
MTMVRKGMLAFAVSAALGLSSLAQADILIGVAGPHTGPNAAFGEQYWRGASQAAADINAA
GGINGEPIKLVKGDDACEPKQAVSVANRLVDQDKVAAVIGHFCSSSTIPASEVYDEAGIL
TITPGSTNPQVTERGLTGMFRMCGRDDQQGQVAADFIVDSLKGKRVAVIHDKDTYGQGIA
DSARAQLSKRGVAAVLYEGLTRGEKDFNALVTKLRGANVDVVYFGGLHTEAGPLLRQMRE
QGLTASFVSGDGVVTDELVTTAGGPQYVKGAFMTFGADPRKIPDGQALVEKLRAGGYEPE
GYTLYAYASLQTLAAAFNAVGKTDSEKAAEWLKSHPVATVMGTKEWDAKGDLKVSDYVIY
EWDDQGKYHQK
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgacgatggtgagaaaaggcatgctggctttcgcggtgtccgccgcgctgggcctgtcc
tccctggcccaggccgacatcctgatcggcgtcgccggtccgcacaccggcccgaatgcc
gccttcggcgagcagtactggcgcggggccagccaggccgcggccgacatcaacgccgcc
ggcggcatcaacggcgagccgatcaagctggtcaagggcgacgacgcctgcgaacccaag
caggccgtctcggtggccaaccgcctggtcgaccaggacaaggtcgccgcggtgatcggc
cacttctgttcctcctcgaccatcccggcctccgaggtgtacgacgaggcgggcatcctc
accatcacccccggctcgaccaacccgcaggtcaccgagcgcggcctgaccggcatgttc
cgcatgtgcggccgcgacgaccagcagggccaggtcgccgccgacttcatcgtcgacagc
ctgaagggcaagcgggtggcggtcatccacgacaaggacacctacggccagggcatcgcc
gattccgcgcgcgcccagctgagcaagcgcggcgtcgccgcggtgctctacgagggcctg
acccgcggcgagaaggacttcaacgcgctggtcaccaagctgcgcggcgccaacgtcgac
gtggtctacttcggcggcctgcacaccgaggccggcccgctgctgcggcagatgcgcgag
cagggcctgaccgccagcttcgtctccggcgacggcgtcgtcaccgacgagctggtcacc
accgccggcggcccgcagtacgtcaagggcgccttcatgaccttcggcgccgacccgcgc
aagatccccgacggccaggcgctggtcgagaagctgcgcgccggcggctacgagccggag
ggctacaccctgtacgcctacgcctccctgcagacgctggccgcggccttcaacgcggtc
ggcaagaccgattcggaaaaggccgccgagtggctgaagagccatccggtggcgaccgtg
atgggcaccaaggagtgggatgccaagggcgacctgaaggtcagcgactatgtgatctac
gagtgggacgaccaaggcaagtatcaccagaagtga

DBGET integrated database retrieval system