KEGG   Azotobacter chroococcum: Achr_18630
Entry
Achr_18630        CDS       T03640                                 
Name
(GenBank) Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB
  KO
K02454  general secretion pathway protein E [EC:7.4.2.8]
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_18630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_18630
Enzymes [BR:acx01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Achr_18630
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_18630
SSDB
Motif
Pfam: T2SSE AAA_16 T2SSE_N AAA_29 AAA_30 AAA_23 ATPase_2 AAA_22 FtsK_SpoIIIE TrwB_AAD_bind ABC_tran AAA_19 AAA_11 ResIII AAA_7 cobW Pox_A32 AAA Zeta_toxin AAA_14 TsaE DUF2520 PhoH DEAD
Other DBs
NCBI-ProteinID: AJE21318
UniProt: A0A0C4WHU9
LinkDB
Position
2063594..2065330
AA seq 578 aa
MDSLSPASAAGAVLPGVDAAGVDEPRPARLEAALLREARERAASEGGRVLEALEALAGLA
PEAFVRRLGATLRYPVLDGETLFACRPVFERLALAQALKREFAVIRLDEREVGVFADPFD
DARLAWIDACLEGAPLYLVHPADLAGYLARHEEAYHAVESLGADAAGAVEAEAVENLSLA
RISEDSSVVVKLVNSTLYDALKMHASDIHLGMTGNGLAIKYRIDGVLNSIGRVQGSEIAD
QVISRVKVLAELDIGEKRVPQDGRFKVGIHGRQIDFRVSIMPSIFGEDAVLRVLDKQDLA
DRVSGVSLEALGFEEATLRILRRLAAEPYGMVLVTGPTGSGKTTTLYAMITEINHGVDKI
ITIEDPVEYQLPGVLQIPVNEKKGLTFARGLRSILRHDPDKIMVGEIRDPETAQIAVQSA
LTGHLVFTTIHANNVFDVIGRFVQMEVDPYSFVSALNAVLAQRLIRLVCPDCAAPVEPSE
EELLTSGLNPAEVGDFRFVHGSGCGRCRGSGYRGRKAIAELLLLDDEIRQLIVERQPISQ
IKELARRRGLRLLRSSAVELVRSGRTTLEEINRVTFVG
NT seq 1737 nt   +upstreamnt  +downstreamnt
atggacagtctttctccagcatccgcagccggcgctgttctgcccggcgtggatgcggcc
ggcgtggacgagccccgccctgcgcggctcgaggcggcgctgctgcgcgaggcccgcgag
cgcgcggcgagcgagggcggacgggtgctcgaggcgctggaggcgctggccgggctggcg
ccggaggcgttcgtccgccgcttgggggcgaccctgcgctacccggtgctcgacggcgag
acgctgttcgcctgccggccggtgttcgagcggctggcgctggcccaggcgctcaagcgc
gaattcgccgtgatccgcctggacgagcgcgaggtcggggtgttcgccgatcccttcgac
gatgcccggctggcctggatcgacgcctgcctggagggcgcgccgctgtacctggtgcat
ccggccgacctggccggctacctggcgcgccacgaggaggcctaccacgccgtcgagtcg
ctgggcgccgacgccgccggggcggtcgaggccgaggcggtggagaacctctcgctggcg
cggatcagcgaggactccagcgtggtggtcaagctggtcaactcgaccctctacgacgcg
ctgaagatgcacgccagcgacatccacctgggcatgaccggcaacgggctggcgatcaag
taccgcatcgacggggtgctcaactccatcggccgggtgcagggcagcgagatcgccgac
caggtgatctcgcgggtcaaggtgctcgccgagctggacatcggcgagaagcgggtgccc
caggacggccgcttcaaggtcggcatccacggccggcagatcgacttccgggtgtcgatc
atgccgagcatcttcggcgaggacgcggtgctgcgggtgctcgacaagcaggacctggcc
gatcgcgtcagcggcgtcagcctggaggcgttgggcttcgaggaggcgaccctgcgcatc
ctgcgccggctggccgccgagccctacggcatggtgctggtgaccggccccaccggcagc
ggcaagaccaccaccctgtacgcgatgatcaccgagatcaaccacggggtggacaagatc
atcaccatcgaggacccggtggagtaccagctgcccggcgtgctgcagatcccggtcaac
gagaagaagggcctgaccttcgcccgcggcctgcgctcgatcctccgccacgacccggac
aagatcatggtcggcgagatccgcgacccggaaaccgcacagatcgccgtgcagtcggcg
ctcaccggccacctggtgttcaccaccatccacgccaacaacgtgttcgacgtgatcggc
cgcttcgtgcagatggaggtcgatccctacagcttcgtctccgcgctcaacgcggtgctc
gcccagcgcctgatccgcctggtctgcccggactgcgcggcgcccgtcgagccgagcgag
gaggaactgctgacctccgggctgaacccggccgaggtcggcgacttccgcttcgtccac
ggcagcggctgcgggcgctgccgcggctcgggctaccgcgggcgcaaggcgatcgccgaa
ctgctgctgctcgacgacgagatccgccagctgatcgtcgagcgccagcccatctcgcag
atcaaggagctggcccgccgccgcggcctgcgcctgctgcgcagctcggcggtggagctg
gtacgcagcggacggaccaccctggaggagatcaaccgtgtcactttcgttggctga

KEGG   Azotobacter chroococcum: Achr_36020
Entry
Achr_36020        CDS       T03640                                 
Symbol
gspE
Name
(GenBank) general secretion pathway protein E
  KO
K02454  general secretion pathway protein E [EC:7.4.2.8]
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_36020 (gspE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_36020 (gspE)
Enzymes [BR:acx01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Achr_36020 (gspE)
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_36020 (gspE)
SSDB
Motif
Pfam: T2SSE AAA_29 AAA_23 Glyco_trans_4_4 T2SSE_N AAA_30 AAA_19 AAA_16 AAA AAA_22 ABC_tran SRP54 AAA_14 AAA_7 cobW Microtub_bd AAA_11
Other DBs
NCBI-ProteinID: AJE22997
UniProt: A0A0C4WVY0
LinkDB
Position
4013292..4014809
AA seq 505 aa
MSDSVFPDEEIRADATPPPQRLPFSFADRYRLVVEPETNRLRCYHIEQTPLEAILEARRF
LDAEFELVPVTAEQLERRLGALYQQSGQADMQLIEKIGDDDDLFELIDELPESEDLLAAE
GDAPIIRLINAMLTEAIKEGASDIHIEPYEKRLSVRFRIDGVLREILSPNYKLATLLTSR
IKVMAKLDIAEKRVPQDGRTALRIGGRALDVRVSTLPSSYGERVVMRLLDKQTARLSLSD
LGMPENAHRTFERLLLQPNGVILVTGPTGSGKTTTLYAGLGMLNNSSRNILTVEDPVEYA
IEGVGQTQVNTRAGMTFAKGLRAMLRQDPDVLMIGEIRDAETAEVAIQASLTGHLVLSTL
HTNSAAGAITRLRDIGIDSYLVASSLKGVLAQRLVRRLCQHCREPARITEEEAQWLNRPE
LAGTDGYRSCGCEQCNQTGYRGRVGIYELAVVDAGLATLINQRAGEMEMQHYLSSKMNSL
MDEARLLVTCGMTSVDEVLRIIRSD
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtccgattcagtgtttcccgatgaagaaatccgggcggacgccacgccccctcctcag
cggctgccgttcagcttcgccgaccgctatcggctggttgtcgagcccgagacgaatcga
ttgaggtgttaccacatcgagcagacacctctcgaggcgatcctcgaggccaggcgtttc
ctcgatgcggaattcgagctggtgccggtcacggccgagcagctggagcggcgcctggga
gcgctctaccagcagagcggtcaggccgatatgcagctgatcgagaagatcggcgacgac
gacgatctgttcgagctgatcgatgaactgccggagagcgaagacctgctcgccgccgag
ggcgatgcgccgatcattcgcctgatcaatgcgatgctgaccgaggcgatcaaggaaggc
gcgtccgatatccatatcgaaccctacgaaaagcgtctgtcggtgcgctttcgcatcgac
ggcgtgctgcgcgagatactgtcgcccaactacaagctggccaccctgctgacctcgcgc
atcaaggtcatggccaagctcgacatcgccgagaagcgcgtgccgcaggacggccgcacg
gcgttgcgcatcggcggccgcgccctcgacgtgcgggtttcgaccctgccgtccagctat
ggcgagcgcgtggtgatgcgcctgctggacaagcagacggcacgcctcagcctcagcgac
ctcggcatgcccgagaacgcccaccggaccttcgagcgcctgttgctgcagcccaacggc
gtcatcctggtcaccggtcccaccggctcgggcaagaccaccacgctctatgccggcctc
ggcatgctcaacaacagctcgcgcaacatcctcacggtggaagatcccgtcgaatacgcc
atcgagggcgtggggcagacccaggtgaatacccgcgccgggatgaccttcgccaagggg
ctgcgggcgatgctgcgccaggacccggacgtgctgatgatcggcgagatccgcgatgcg
gaaaccgccgaggtggcgatccaggccagtctgaccggccacctggtgctgtcgaccctg
cacaccaacagtgcggccggcgcgatcacgcgcctgcgcgacatcggcatcgactcctat
ctggtggcgtccagcctgaaaggcgtgctggcccagcggctggtgcggcgactctgccag
cactgccgcgaaccggcgcggatcaccgaggaggaagcgcagtggctcaacaggcccgaa
ctggcgggaacggatggctatcgcagctgcggctgcgagcagtgcaaccagaccggctat
cgcggccgggtcggcatctatgagctggcggtggtggacgccggactggcgaccctgatc
aaccagcgggccggcgagatggagatgcaacactatttgagcagcaagatgaattccctg
atggacgaggcgcgccttctcgttacctgcggcatgacgagcgtcgacgaagtgctgcgc
atcattcgcagcgattga

KEGG   Azotobacter chroococcum: Achr_36250
Entry
Achr_36250        CDS       T03640                                 
Name
(GenBank) Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB
  KO
K02454  general secretion pathway protein E [EC:7.4.2.8]
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_36250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_36250
Enzymes [BR:acx01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Achr_36250
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_36250
SSDB
Motif
Pfam: T2SSE T2SSE_N AAA_16 AAA_22 AAA_29 NTPase_1 AAA_14 AAA_19 Rad17 AAA_11 AAA_7 AAA_30 Zeta_toxin AAA_23 cobW ResIII ABC_tran ATPase_2 AAA AAA_33 FtsK_SpoIIIE Microtub_bd
Other DBs
NCBI-ProteinID: AJE23020
UniProt: A0A0C4WTL6
LinkDB
Position
4038447..4040231
AA seq 594 aa
MPSIASSPEDRWLDLGDLLRALVAQGRIGQDSAEQCLAIRRSALDSQQHPLEFLAAQQPD
DRAQPGRKLDLESLTQWLAGHAGQPYLRIDPLKIDVAAITPLMSYAFAQRHKILAVAVAP
DGVTVASAQPFVSSWEANLTHVLRRPIRRVVANPAEIQRFTQEFYRLARSVSGASATEQK
ISGVGNFEQLLKLGAADQEPDANDAHIVTIVDWLFQYAFQQRASDIHIEPRREAGSVRFR
IDGVLHNVYQFPPQVTMAVVSRLKSLGRMNVAEKRKPQDGRVKTRSPDGGEIELRLSTLP
TAFGEKLVMRIFDPEVLLKSFDALGFSADDLRRWQSMTAQPNGIILVTGPTGSGKTTTLY
TTLKQLATPEVNVCTIEDPIEMIEPAFNQMQVQHNIDLTFASGVRALMRQDPDIIMVGEI
RDLETAEMAIQAALTGHLVLSTLHTNDAPSAITRLLELGVPYYLIKATLLGVMAQRLVRT
LCPHCKAPVELDAADWQTLTRPWNAPLPSGAHRAVGCPECRDTGYRGRAGVYEIMLLNDA
LKPLIAADTDLLALRRAAFKDGMRSLRLSGALKVAAGSTTLEEVMRVTPQSEQR
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgccttccatcgcttcttcccccgaggaccgctggctcgacctgggcgacctgctgcgc
gcgctggtcgcccagggccggatcggccaggacagcgccgagcagtgcctggcgatccgc
cgcagcgcgctggacagccagcagcatccgctggagttcctcgccgcccagcagcccgac
gaccgtgcccagccggggcgcaagctcgacctggaaagcctcacccagtggctggccgga
catgccgggcagccctacctgcgcatcgacccgctgaagatcgacgtcgccgcgatcacc
ccgctgatgtcctacgccttcgcccagcgccacaagatcctcgccgtggcggtcgccccg
gacggcgtcaccgtcgccagcgcgcagccgttcgtcagcagctgggaagccaacctgacc
catgtgctccgccggccgatccgccgggtggtggccaatccggcggagatccagcgcttc
acccaggagttctaccgcctggccagatcggtcagcggcgcctcggccacggagcagaag
atcagcggcgtcggcaacttcgagcagttgctcaagctcggcgcggcggaccaggagccg
gacgccaacgacgcgcacatcgtcaccatcgtcgactggctgttccagtacgccttccag
cagcgcgccagcgacatccacatcgagccgcgccgcgaggccggcagcgtgcgctttcgc
atcgacggcgtgctgcacaacgtctaccagttcccgccgcaggtgaccatggcggtggtc
agccggctgaaatccctcggccggatgaacgtcgccgagaagcgcaagccgcaggacggc
cgggtcaagaccaggagcccggacggcggcgagatcgagctgcgcctgtccaccctgccc
accgccttcggcgagaagctggtgatgcgcatcttcgaccccgaggtgctgctcaagagc
ttcgacgccctcggcttctccgccgacgacctgcgccgctggcagagcatgaccgcccag
cccaacggcatcatcctggtcaccgggccgaccggctcgggcaagaccaccacgctctac
accaccctgaaacaattggcgacgccggaggtcaacgtctgcaccatcgaagaccccatc
gagatgatcgagccggcgttcaaccagatgcaggtgcagcacaacatcgacctgaccttc
gccagcggcgtgcgcgcgctgatgcgccaggacccggacatcatcatggtcggtgagatc
cgcgacctggaaaccgccgagatggccatccaggcggcgctcaccggccacctggtgctc
tccaccctgcacaccaacgacgcacccagcgccatcacccgcctgctcgagctgggcgtg
ccctactacctgatcaaggccaccctgctcggggtcatggcccagcgcctggtacgcacc
ctgtgcccgcactgcaaggcgccggtcgaactcgacgcggccgactggcagacgctgacc
cggccctggaacgccccgctgccgagcggcgcgcaccgggcggtgggctgccccgaatgc
cgcgacaccggctaccgcgggcgggccggggtctacgagatcatgctgctgaacgatgcc
ctcaagccgctgatcgcggccgataccgacctgctcgccctgcgccgcgccgccttcaag
gacggcatgcgcagcctgcgcctatccggcgcgctgaaggtcgccgccggatcgaccacc
ctggaggaggtcatgcgcgtcaccccacagagcgaacagcgctga

DBGET integrated database retrieval system