KEGG   Azotobacter chroococcum: Achr_18680
Entry
Achr_18680        CDS       T03640                                 
Name
(GenBank) type II and III secretion system protein
  KO
K02453  general secretion pathway protein D
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_18680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_18680
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_18680
SSDB
Motif
Pfam: Secretin STN Secretin_N TPR_14 TPR_16 TPR_19
Other DBs
NCBI-ProteinID: AJE21323
UniProt: A0A0C4WHV0
LinkDB
Position
2067738..2069543
AA seq 601 aa
MPVLLGSVLLSGCAGQPGKEGIALIDQGKYEEGLAQLAEAAHEDSQDPGAQIALTTQRAV
VVTRLLAQAEQARAAGNNEAAQATFQRVLGIEPGNARAREGMRQIVQLRNVAEQYRQAEL
ALARGDLAGAERLVRAILVLEPRHEGALALQEGIEGTRAQTAVAYPQLRSRLQKPVSLEF
REANLKLVFEVLAQTAGMNFIFDQDVRPDLKATIYVRQVAIEDAVDLLLQQSQLKQKVVN
DNTIVIYPNTPQKLKDYQELVLRTFYLTNTDANTALNMVKTLLKTRDVFVDERLNTLTMR
DTPDAVHLAERLFQAQDQANPEVVLELEVMEVSRKRILDLGLQWPNTFGILTEDGGSAVS
ILGQLRGINSDRINFSPSPTLKINANDSDINTLASPVLRVSNREQARIHIGERVPVVSAT
STPSTQGPVITESITYLDVGLKLEVEPTIHLNDEVAIKVGLEVSNATQQPATAAGTIPVQ
VDTRNAVTTLRLRNGETQVLAGLMRNDHGKSGDRIPGLGDIPGLGRLFGSNKDTLSKSEL
VLSITPHIVRNLPYQSPYDMEFESGTESGLRLRPAALPREGEASRRRPGAEPLAAAGLDQ
P
NT seq 1806 nt   +upstreamnt  +downstreamnt
ttgcccgtgctgctggggagcgtgctgctgtccggctgcgccgggcagccgggcaaggag
ggtatcgccctgatcgaccagggcaagtacgaggaaggcctggcgcaactggccgaggcg
gcgcatgaggattcgcaggatcccggcgcgcagatcgccctgaccacccagcgggcagtg
gtggtcacccggctgctggcccaggccgagcaggcgcgcgccgcgggtaacaacgaggcg
gcgcaggctaccttccagcgggtgctgggcatcgagccgggcaacgcccgggcccgcgag
ggcatgcgccagatcgtccagctgcgcaatgtcgccgagcagtaccgccaggccgagctg
gccctggcccgcggcgacctggccggggccgagcggctggtgcgcgcgatcctcgtcctg
gagccgcggcacgagggggcgctggccctgcaggagggcatcgagggaacccgcgcgcag
accgccgtcgcctatccgcagctgcgctccaggctgcagaaaccggtgagcctggagttc
cgcgaggccaacctgaagctggtgttcgaggtgctggcgcagaccgcggggatgaacttc
atcttcgaccaggacgtgcgcccggacctcaaggcgaccatctacgtccgccaggtggcc
atcgaggatgcggtggacctgctgctgcagcagagccagctgaagcagaaggtggtcaac
gacaacaccatcgtcatctacccgaacaccccgcagaagctcaaggactaccaggagctg
gtgctgaggaccttctacctgaccaacaccgacgccaataccgcgctgaacatggtcaag
accctgctcaagacccgcgacgtgttcgtcgacgagcgtctcaacaccctgaccatgcgc
gacacaccggatgcggtgcacctggccgagcggctgttccaggcccaggaccaggccaac
ccggaggtggtgctggaactggaggtgatggaagtctcgcgcaagcgcatcctcgacctc
ggcctgcagtggccgaacaccttcggcatcctcaccgaggacggcggcagcgcggtgagc
atcctcggccagctgcgcgggatcaattccgaccgcatcaacttctcgccctcgccgacc
ctgaagatcaacgccaacgacagcgacatcaacaccctcgccagcccggtgctgcgggtc
agcaaccgcgagcaggcgcgcatccacatcggcgagcgggtgccggtggtcagcgccacc
tcgacgccctcgacccaggggccggtgatcaccgagagcatcacctacctggacgtgggc
ctgaagctggaggtcgagccgaccatccacctgaacgacgaggtggccatcaaggtgggg
ctggaggtgagcaacgcgacccagcagccggccaccgcggccgggaccatcccggtccag
gtggacacccgcaacgcggtcaccaccctgcgcctgcgcaacggcgaaacccaggtgctg
gccggcctgatgcgcaacgaccacggcaagtcgggcgaccgcattcccggcctcggcgac
atccccggcctcggccggctgttcggcagcaacaaggacaccctgagcaagtccgagctg
gtgctgtcgatcaccccgcacatcgtgcgcaacctgccgtaccagagcccctacgacatg
gagttcgagtccggcaccgagagcggcctgcgcctgcggccggccgcgctgccccgcgag
ggcgaggccagccggcgccggccgggcgccgagccgctggccgccgccggtctggatcag
ccatga

KEGG   Azotobacter chroococcum: Achr_36010
Entry
Achr_36010        CDS       T03640                                 
Symbol
gspD
Name
(GenBank) general secretion pathway protein D
  KO
K02453  general secretion pathway protein D
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_36010 (gspD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_36010 (gspD)
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_36010 (gspD)
SSDB
Motif
Pfam: Secretin Secretin_N BRCT HopW1-1
Other DBs
NCBI-ProteinID: AJE22996
UniProt: A0A0C4WQL0
LinkDB
Position
4011363..4013285
AA seq 640 aa
MLACPAGADDYSLDMRDTDISEFIASIGKLTGKTIVMDPRVKGKVSISTPKSVTKEELYE
IFLVQLGVNGYSVINVGKDILKVIPQQGAKLEGIEVQGGSNSPTHTSERIVTRVVQVQNV
DVAALVPILRPLVDNQSGIITPYPASNVILITDREANVRRLLEVIERVDKADSDDTEIIW
LENASAPEVSETLTALIREQTKGSEGSRLMPIIKADARTNSLLIRADESNREYLRQVIKE
LDSEVQTDNNTRVHYLKYAKAEDLAEVLEKISGTIIEENKDSAEPVATKQGAIHIKAHEA
TNSIVMSGSPRIIRDLGQLIEQLDIRRAQVLVEAIIVEMGEDRAKEVGVQWLLADRNGSG
RALAGTNFTNLGNSLNGILDATSDGEQSVAGALRNVGGLTAGVGRLSGSGLNFAVLLKAL
QDDLKSNILSTPSLLTLDNQAASILVGQEIPVSTGSTLSNDNDANNQFRTIERKDVGVKL
LITPQINEGGAVQLQIEQEVSSVGDQVGDDGVSFNKRQIKTAVLVDNGATIVLGGLIDDD
IREVGSKVPGLGSLPVVGRLFRSDSSRITRRNLMVFIRPTIIRDQEMLSSVSKAKYGFIR
DRQLADKDSAVELFPEERPAVLPEWTGLGPTSINVLPPKK
NT seq 1923 nt   +upstreamnt  +downstreamnt
ttgctggcatgcccggccggggccgacgactacagcctcgacatgcgcgacaccgatatt
tcggagttcatcgccagcatcggaaagctcacgggcaaaaccatcgtcatggacccgcgc
gtcaagggaaaggtcagcatcagcactccgaaatcggtgaccaaagaggaactctacgaa
atctttctggtgcagctcggcgtcaatggatactccgtcatcaatgtgggaaaagacatt
ctgaaggtgattccccagcaaggcgcgaaactggaagggatcgaagttcagggtggcagc
aattccccgacgcataccagtgaaagaatcgtcacccgtgtcgttcaggtgcaaaacgtc
gacgtagccgccctggtgcccatcctgcgtccgctggtggataaccagagcggcatcatc
acgccctaccccgcctccaacgtcattctgatcaccgaccgcgaggccaatgtccggcgg
ctattggaggtcatcgagcgggtggacaaggccgatagcgacgataccgagatcatctgg
ctggagaatgcctccgcgccggaagtgagcgaaaccctgacggcattgatccgcgagcag
accaagggcagcgaaggctcgcgcctgatgcccatcatcaaggcggacgcccggaccaac
agcctgttgatccgggccgacgaatcgaatcgcgagtatctccgccaggtcatcaaggaa
ctcgacagcgaggtccagaccgacaacaacacccgggtccactacctcaaatacgccaag
gccgaggacctggcggaggtgctggaaaagatcagcggcaccatcatcgaggaaaacaag
gactccgcggagcccgtcgcaaccaaacagggcgccatccatatcaaggcccacgaggcg
accaacagcatcgtcatgtcgggcagcccgaggatcattcgcgacctcgggcaattgatc
gagcaactcgatatccgccgcgcgcaagtcctggtggaagcgatcatcgtcgagatgggg
gaagatcgggccaaggaagtgggcgtccagtggctgctcgcagatcgcaacggcagcgga
cgggcactggcaggaaccaacttcaccaatctcggcaatagcctcaacgggatattggac
gccacctccgatggcgagcagtcagtggcaggcgcactgagaaacgtcggcggcctgact
gccggcgtggggcgcctcagcggttcgggcctgaacttcgccgtactcttgaaggcgctg
caggacgatttgaaatcgaacattctctccacccccagcctgctgaccctggacaaccag
gcggcctccatactggtgggccaggaaatacccgtgtccacgggttcgacgctcagtaac
gacaacgatgcgaacaaccaatttcggacgatcgagcgcaaggacgtcggcgtcaagctg
ctcatcaccccgcagatcaacgagggcggtgccgtgcaactgcagatcgaacaggaagtc
tcctcggtgggcgatcaggttggcgatgacggcgtcagcttcaacaagcgtcagatcaaa
accgccgtcctggtcgataacggtgcgaccatcgtcctgggcggattgatcgacgacgac
atccgcgaggtgggatcgaaggtgcccgggctgggcagtttgccggtggtgggtcgcctg
ttccgctcggacagcagtcggattacccgtcgcaatctgatggtcttcatacgccccacc
atcattcgcgaccaggagatgctgtcctcggtcagcaaggccaaatacggtttcattcgg
gaccggcaactggcagacaaggacagcgccgtggagctgtttccggaagagaggccggcg
gtcctgcccgagtggacggggcttggccccacgtcgatcaacgttctgccgcccaagaag
taa

KEGG   Azotobacter chroococcum: Achr_8610
Entry
Achr_8610         CDS       T03640                                 
Name
(GenBank) General secretion pathway protein D
  KO
K02453  general secretion pathway protein D
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_8610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_8610
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_8610
SSDB
Motif
Pfam: Secretin Secretin_N
Other DBs
NCBI-ProteinID: AJE20347
UniProt: A0A0C4WQ26
LinkDB
Position
955713..957002
AA seq 429 aa
MQDFVEWSSTQLNRSVVVGADIRSAPISIFATFDSPAALEKLVEEAVLSSGFHFSSFDGV
IRIGSAPFKAPLDLVTEVVQLQHLQSDFAFQAVRDVLASRAAGDDKSAPAVSQASVSPSP
TSNALIVTATRDQLAAIRTVLAEIDRPRRQVVITAVVAELADDDFEALGLNVSLDSGNTS
LAGVTIGSSDFASDLGFSLTFSGPTLGAFLRAVRSTGNNKILSTPQLLTLNREAASIVVG
QNVPFVTGQTTSGSTPASDPFQTIVRQDVGVSLSVTPFITPADAIELEVEQSASSVSDDR
TAADIITNTRRILTKVQLKDGEGVLLGGLRSEQTDKSSSAVPILSEIPWLGKVFRSRSSR
VRATNLVVLLTAKVYRDGDAMGVPQALREPARLMLPALGVAPGGIGAAGDTGGQVEGLSG
GPAPVGFRP
NT seq 1290 nt   +upstreamnt  +downstreamnt
ttgcaggattttgttgaatggtcgtctactcaactcaaccgctcggttgttgtcggcgct
gatattcgatccgctccgatttccatttttgccacatttgattcgccggctgccctggaa
aagctggtcgaggaagcggtgctttcctcagggtttcacttctcgtcgtttgatggggtg
attcgcattggctcggcgccgttcaaggctccgctcgacctggtgacggaagtcgtgcag
ctgcagcatctgcaaagcgattttgcctttcaggcggtgcgtgatgtgctggcttcacgg
gcggctggcgatgacaagtccgctccggcggtatcccaggcgtcggtgagtccttcgccg
acctctaatgccttaatcgtcactgccacgcgggaccagctggcggctattcgcacggtg
ctggctgaaatcgaccggcctcgtcgccaggtggtgatcaccgccgttgttgctgagctg
gccgacgatgatttcgaggctttggggctgaatgtctctctcgactccggcaataccagt
ctggccggcgtgactattggctcgtccgacttcgcttccgatctcggtttcagcttgacc
ttctcggggccgaccttgggggctttcctgcgtgctgtacgctccacgggcaataacaag
atcctcagcacgcctcagttgttgacgctcaaccgcgaggccgcgtccatcgtcgtgggg
cagaatgtgcctttcgtcactgggcagaccaccagcgggtcaacgcctgcgtccgatcct
ttccagaccatcgttcgccaggatgtgggcgtttccctgtctgtcacgccgtttatcacg
ccagccgatgctatcgagcttgaggtggagcagtccgcgtcttcggtttccgacgacagg
accgctgccgacatcatcaccaacacgcggcgcattctgaccaaggtacagctgaaggac
ggcgagggcgtgttgctcggcggcttgcgttccgaacagacggataagtcctcttcggcg
gtgccgatcctttcggagattccctggttggggaaggtctttcggtctcgttcgtctcgg
gttcgggctaccaatctcgtcgtgctgctgactgccaaggtttatcgggatggggatgct
atgggagttcctcaggcgctacgcgagccggcgcggctcatgttgccggctctcggcgtg
gcccctgggggcatcggcgcagccggtgacaccgggggccaggtcgagggcctttctggt
gggcctgctccggtggggttccgcccctga

DBGET integrated database retrieval system