KEGG   Azotobacter chroococcum: Achr_18690
Entry
Achr_18690        CDS       T03640                                 
Name
(GenBank) G protein signal peptide-like secretion type II protein
  KO
K02456  general secretion pathway protein G
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_18690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_18690
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_18690
SSDB
Motif
Pfam: N_methyl
Other DBs
NCBI-ProteinID: AJE21324
UniProt: A0A0C4WLU0
LinkDB
Position
2069540..2070013
AA seq 157 aa
MRSRARGFSLLELVIALAILGLLVGMAAPLTETVIRRGKEQELKTALYRIRDAIDAYKQA
ADAGFIEKSALGSGYPPSLEVLVEGVRDLRNPSGSKLYFLRRIPRDPFAEPGASALESWG
LRSYDSSAENPQEGEDVFDVHSLSESRGLNGIPYGEW
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaggagcagggcgcgcggcttctcgctgctcgagctggtgatcgccctggcgatcctc
gggctgctggtcggcatggccgcgccgctgaccgagacggtgatccgccgcggcaaggag
caggagctgaaaaccgcgctgtaccgcatccgcgacgccatcgacgcctacaagcaggcg
gccgacgccggcttcatcgagaagtccgccctcggcagcggctatccgccctcgctggag
gtgctggtggagggcgtccgcgacctgcgcaacccgtcggggagcaagctctatttcctc
cggcggattccccgcgaccccttcgccgagccgggcgcgagcgcgctggagagctggggg
ctgcgcagctacgacagttccgcggagaacccgcaggagggcgaggacgtcttcgacgtc
cattcgctgtccgaaagccgcgggctcaacggcattccgtacggggagtggtaa

KEGG   Azotobacter chroococcum: Achr_18700
Entry
Achr_18700        CDS       T03640                                 
Name
(GenBank) Type II secretion system protein G
  KO
K02456  general secretion pathway protein G
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_18700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_18700
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_18700
SSDB
Motif
Pfam: N_methyl T2SSG DUF5411
Other DBs
NCBI-ProteinID: AJE21325
UniProt: A0A0C4WP43
LinkDB
Position
2070016..2070390
AA seq 124 aa
MRRQAGFTLIELLVVMAIIASLLTIAVPRYFSSLEYSRETTLKQSLAVMRDALDQYYGDT
GSYPESLEALVEQRYLRNLPVDPISERSDQWVVLPPPEGVPGSVADVRSGADGRAKDGSL
YAEW
NT seq 375 nt   +upstreamnt  +downstreamnt
atgcgacgacaggccggattcaccctgatcgagctgctggtggtcatggcgatcatcgcc
agcctgctgaccatcgccgtgccgcgctatttctccagcctcgagtattcccgggaaacc
accctcaagcagagcctggcggtgatgcgcgatgccctggaccagtactacggcgacacc
ggcagctatccggagagcctcgaggcgctggtggagcagcgctacctgcgcaacctgccg
gttgacccgatcagtgagcgcagcgaccagtgggtggtattgccgccgcccgagggggtt
cccggcagcgtcgccgacgtcaggagcggcgcggacgggcgggccaaggacggcagcctg
tatgccgagtggtga

KEGG   Azotobacter chroococcum: Achr_19160
Entry
Achr_19160        CDS       T03640                                 
Symbol
gspG1
Name
(GenBank) General secretion pathway protein G
  KO
K02456  general secretion pathway protein G
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_19160 (gspG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_19160 (gspG1)
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_19160 (gspG1)
SSDB
Motif
Pfam: T2SSG N_methyl NDUF_B12
Other DBs
NCBI-ProteinID: AJE21371
UniProt: A0A0C4WM46
LinkDB
Position
complement(2131076..2131504)
AA seq 142 aa
MQTLAQARRSPGFTLLELLVVLVVLGLLAGIVGPKYFNQLGRSETKVARAQIEGLSKALD
IYRVETGRYPSTEQGLNALVAAPSDEPRWSGPYLQKGVPQDPWGRAYVYRSPGENGDYDL
LTLGKDGQPGGEGENAEITSWQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcaaacccttgcccaggcccgccgcagtccgggcttcaccctgctggaactgctggtc
gtgctggtcgtgctcggcctgctggccggcatcgtcggccccaaatatttcaaccagctc
ggccgctcggaaaccaaggtcgcccgcgcgcagatcgagggcctgagcaaggcgctggac
atctaccgcgtggaaaccggccgctaccccagcaccgagcagggcctcaacgccctggtc
gcggcgcccagcgacgagccgcgctggtccggcccctacctgcagaaaggcgtgccgcag
gacccctggggccgcgcctacgtctaccgctcgccgggcgagaacggcgactacgacctg
ctgaccctgggcaaggacggccagcccggcggcgaaggcgagaacgcggaaatcaccagc
tggcaatga

KEGG   Azotobacter chroococcum: Achr_36040
Entry
Achr_36040        CDS       T03640                                 
Symbol
gspG
Name
(GenBank) general secretion pathway protein G
  KO
K02456  general secretion pathway protein G
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_36040 (gspG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_36040 (gspG)
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_36040 (gspG)
SSDB
Motif
Pfam: T2SSG N_methyl TIMELESS
Other DBs
NCBI-ProteinID: AJE22999
UniProt: A0A0C4WQR2
LinkDB
Position
4016046..4016477
AA seq 143 aa
MKATIRTRRQRGFTLLEIMVVLVILGLLVALVAPNVLQNQDRAMVEKAKADVALLEQALD
MYKLDNFQYPTTNQGLEALVTKPEIDPQPKRYNSNGYIKRLPQDPWGNPYQYLQPGTKKA
FDVYSLGADGEMGGEGLAADIGN
NT seq 432 nt   +upstreamnt  +downstreamnt
ttgaaagcaacgatccgaacgcgccggcaacggggcttcaccctgctggaaatcatggtg
gtgctggtgattctgggcctcctggtggcgctggtggcgccgaatgtcctgcagaaccag
gacagggcaatggtcgaaaaggccaaggccgacgtcgccctgctggagcaggcgctggac
atgtacaagctggacaacttccagtaccccaccaccaaccaggggctggaggcgctggtg
acgaaaccggaaatcgacccgcagcccaagcgctacaacagcaacggctacatcaagcgc
ctgccccaggacccctggggcaatccctaccagtacctgcagccgggcaccaagaaggcg
ttcgacgtctactcgctgggcgcggatggcgagatggggggagaagggcttgcagccgat
atcggcaactag

DBGET integrated database retrieval system