KEGG   Azotobacter chroococcum: Achr_19150
Entry
Achr_19150        CDS       T03640                                 
Symbol
gspF
Name
(GenBank) Type II secretion system protein F
  KO
K02455  general secretion pathway protein F
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_19150 (gspF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_19150 (gspF)
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_19150 (gspF)
SSDB
Motif
Pfam: T2SSF
Other DBs
NCBI-ProteinID: AJE21370
UniProt: A0A0C4WP82
LinkDB
Position
complement(2129873..2131063)
AA seq 396 aa
MRFQIKGMRKTAEVVSLVLDAPSPTDALRLAEHQGLKVLSLRAERRWSPARWRRREAFPL
VLFSQELTTLLNAGLALIDALESLAEKESDAQARKILSDLVRLLYEGKSLSQALGEFPSI
FPPLYVALVQSSEKTGAVGDALGRYVAYRTRMDEVRQKIVSASVYPLLLLLVGNGVLLFL
IGYVVPRFSLVFEGLGSNLPWLSQVLLSVGQFIHTHQNALLGSLLPVLAALVVLLRQERV
RRALGRLVEKVPTIRERLFIYEMARFYRSLGILLQGGIPILTALGMVRGLLGPASRVRLD
RAGELIREGHALSRSLEENRLATPVSLRMLRAGEQAGNLGVMMERTADFYDEETGRWIDW
FVRLFEPLLMTFIGLVIGVIVILMYMPIFELASSIQ
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgcgctttcagatcaagggcatgcgcaagacggcggaagtggtgtcgctggtcctcgac
gccccgagcccgaccgacgccctgcgcctggccgaacaccagggcctgaaggtgctcagc
ctgcgcgccgaaaggcgctggtcgccggcccgctggcggcgccgcgaagccttcccgctg
gtgctgttcagccaggagctgaccaccctgctgaacgccggcctagcgctgatcgacgcc
ctcgaaagccttgccgagaaggaatccgacgcccaggcgcgcaagatcctgagcgacctg
gtgcgcctgctctacgagggcaagtccctctcccaggcgctgggcgagtttccctcaatc
tttccccccctctatgtggcgctggtgcagtcgagcgagaagaccggcgcggtcggcgac
gccctgggacgctacgtcgcctaccgcacgcgcatggacgaggtgcgccagaagatcgtc
agcgcctcggtctatccgcttttgctgctgctggtcggcaacggggtgctgctgtttctg
atcggctacgtggtgccgcgcttcagcctggtcttcgagggactcggctccaacctgcca
tggctgtcgcaggtgctgctgagcgtcgggcagttcattcatacccatcagaatgcactg
ctcggcagcctgctgccggtcctggccgccctcgtcgtcctgctgcgccaggaacgggtg
aggcgagccctcggccggctggtcgagaaagtcccgaccatccgcgagcgcctgttcatc
tacgagatggcgcgcttctaccgttccctgggcatcctgctgcagggcggcatccccatc
ctcaccgccctgggcatggtccgcggcctgctcggccccgcctcgcgcgttcgtctggac
cgggccggtgagctcatccgcgaaggccacgccctgtcccgctcgctggaggaaaaccgc
ctggcgaccccggtttccctgcgcatgctgcgcgccggcgaacaggccggcaatctcggg
gtcatgatggagcgcaccgcggacttctacgacgaggaaaccggccgctggatcgactgg
ttcgtgcgcctgttcgaaccgctgctgatgaccttcatcggcctggtcatcggcgtgatc
gtgatcctgatgtacatgccgatcttcgagctggcgtcgagtatccagtag

KEGG   Azotobacter chroococcum: Achr_36030
Entry
Achr_36030        CDS       T03640                                 
Symbol
gspF
Name
(GenBank) General secretion pathway protein F
  KO
K02455  general secretion pathway protein F
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_36030 (gspF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_36030 (gspF)
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_36030 (gspF)
SSDB
Motif
Pfam: T2SSF Neurensin DUF5383 DUF6724
Other DBs
NCBI-ProteinID: AJE22998
UniProt: A0A0C4WK04
LinkDB
Position
4014815..4016032
AA seq 405 aa
MAAFSYRALTTDGKTRNGLIEADSPRHARAMLRERGLLPTAVEAAGPARATRTGKFRLVR
PLPARDVALLTRQLATLIDSGLPLEEALYAITRQTSNALLKATVLSVRARILEGHSLASA
LSEYPRSFNELYRAMITAGEESGHLSGVLLRLAEYGERLQKIRSKVQVALIYPVFLTLVA
VGVIVLLLTYVVPKVVEQFTHAEQTLPLLTRYLILISDVLQQYGLHMLAALAGLALLARW
WLSDGGRRTRWHKAQLRLPLVSTFVLGQQSLQFARTLAILVGSGIDLLHSLKVSAGPMTN
LYLKQAVVNTGDLVREGCSLSRALEQSGPFPPLLVYMIANGERSGELEKMLDKAAENQEA
EFESRVAWLLGLFEPALILVMGGIVLCIVLAILMPILELNNLTSF
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggccgccttcagctaccgcgcactgaccaccgacggcaagaccaggaacggcctgatc
gaagccgactcgccacgccatgcccgcgccatgctgcgcgaacggggcctgttgcccacc
gccgtggaggcggccggcccggcccgcgccaccaggaccggcaaattccgcctggtccgg
ccgctgccggcgcgcgacgtggcgctgctgacccggcaactggcgaccctgatcgactcc
ggcctgccgctggaagaggcgctctatgccataacccggcaaaccagcaatgccttgttg
aaagcgacagtactatccgtgcgggcgcggattctggagggccacagcctcgcctcggcg
ctgtcggaatacccgcgcagcttcaacgagctgtaccgggcgatgatcaccgccggcgag
gaatcggggcacctgagcggcgtgctcctgcgtctggcggaatatggcgagcggctgcag
aagatccgcagcaaggtgcaggtggcgctgatctatccggtgtttctgacgctggtggcg
gtgggggtcatcgtcctgctgctgacctacgtggtgcccaaggtggtggagcagtttacc
catgccgaacagacgctgccgctgctgacccgctacctgatcctgatcagcgatgtcctg
cagcaatacggcctgcacatgctcgcggcgctggcgggcctcgcgctgctggcgcgctgg
tggctgagcgatggcggacggcgcacccgctggcacaaggcgcagctgcgcctgccgctg
gtcagcaccttcgtgctgggccagcagtcgctgcagttcgcccggaccctggcgatcctg
gtcggcagcggcatcgacctgctgcacagcctgaaagtctccgccgggccgatgaccaac
ctctacctgaaacaggcggtggtcaacaccggcgacctggtgcgggaaggctgctcgctg
tcccgcgccctcgaacagtccggccccttcccgccgctgctggtgtacatgatcgccaac
ggcgagcgcagcggcgagctggagaagatgctggacaaggcggccgagaaccaggaggcg
gagttcgaaagccgtgtcgcctggctgctcgggctgttcgagcccgcgctgatcctggtc
atgggcggcatcgtgctgtgcatcgtcctggccattctcatgccgatcctggaactcaac
aacctgacctcgttttga

DBGET integrated database retrieval system