KEGG   Azotobacter chroococcum: Achr_24380
Entry
Achr_24380        CDS       T03640                                 
Name
(GenBank) Hypothetical protein
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_24380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acx01001]
    Achr_24380
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_24380
Enzymes [BR:acx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Achr_24380
Protein kinases [BR:acx01001]
 Serine/threonine kinases: Other
  Bacterial family
   Achr_24380
Secretion system [BR:acx02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Achr_24380
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 TPR_2 APH Kdo TPR_14 RIO1 Pkinase_fungal DUF4131
Other DBs
NCBI-ProteinID: AJE21874
UniProt: A0A0C4WMZ9
LinkDB
Position
complement(2730631..2732349)
AA seq 572 aa
MNDSVLDIPGYRLHGLLGKGGMAAVYLATQQSLQRQVAIKVLGKAEDQSFILRFIREGHL
VASLHHPSIITIHDIDQLPDGRHYLAMEYLPGGDLARHKGELFAPERAREIVRQIASGLA
VVHAKGLVHRDVKPANILFRGDGTAVLTDFGVAKDLDLDSELTQFGIAVGSPAYSSPEQA
QCQPLDARSDIYSLGVILLEMLTGANPFRGSNYTQTVMNHVQLPLPSLPGSLGPFRGVLE
RMLAKEPEQRFANCQELLAALDALELGDPDETRLGPGLQLSASRIEEDTPAARPAPRRAR
WPAVLGVLLLGGALAGGGFYWQQQRQVDDLLARAERRLAEGQLLAPAQDSAEHYFREALR
LDARSQAAQTGLARVRAAHIAGLLTLGDQRLSEGRLQEPAQDSAAHYFRQVLELDAGNAE
ALDGLRRLLEARIAGHLARAEQSVADKRLLTPEDDSAVYYYRQILGWAPSNEQALAGLHR
VASQYRDLANSAYRRRDFPAALAMIERGLQAEPENPELLKMRDEHQELLASARAARAAQS
SRPVQRTSAPPSEPPVENGNPIKRAWNNLFGN
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgaacgacagcgtgcttgatattcccggttaccgcctgcatggcctgctgggcaagggc
ggcatggccgcggtctacctggccacccagcaatcgctgcagcgccaggtggcgatcaag
gtgctgggcaaggccgaggaccagagcttcatcctgcgcttcatccgcgagggacatctg
gtcgcgtccctgcaccatccctcgatcatcaccatccacgacatcgaccagttgcccgac
ggccgccactacctggccatggagtacctgcccggcggcgacctggcgcgccacaagggc
gagctgttcgccccggagcgggcccgggagatcgtccggcagatcgccagcggcctggcg
gtggtgcacgccaaggggctggtgcaccgcgacgtgaagccggccaacatcctgtttcgc
ggcgacggcaccgcggtgctcaccgacttcggcgtggccaaggatctcgacctcgacagc
gagctgacccagttcggcatcgccgtcggcagcccggcctacagcagcccggagcaggcg
cagtgccagccgctggatgcgcgcagcgacatctacagcctcggcgtgatcctgctggag
atgctcaccggcgccaaccccttccgcggcagcaactacacccagacggtgatgaaccac
gtgcagctgccgctgccgagcctgccgggttcgctcgggccgttccgcggcgtgctcgaa
cgcatgctcgccaaggagccggagcagcgcttcgccaactgccaggaactgctggcagcg
ctggatgcgctcgagctgggcgatcccgacgagacgcgcctcggccccggcctgcagctg
agcgccagccgcatcgaagaagacaccccggcggcccggcccgcgccgcgccgcgcgcgc
tggccggcggtgctcggcgtcctgctgctgggcggcgcgctggccggcggcggcttctac
tggcagcagcagcggcaggtcgacgacttgctcgccagggccgaacggcgcctggccgag
gggcaactgctggcgccggcgcaggacagcgccgagcactacttccgcgaggcgctgcgc
ctggatgcgcgcagccaggccgcccagaccggactcgcgcgggtccgggccgcgcacata
gctggcctcttgaccctcggcgaccagcgcctgagcgaggggcggctgcaggagccggcg
caggacagcgcggcgcattacttccgccaggtcctcgaactggacgccggcaacgccgag
gccctcgatggtctgcgccgcctgctcgaggcgcgcatcgccggccatctggcgcgcgcc
gagcagagcgtcgccgacaagcgcctgctgacgcccgaggacgacagcgcggtctactac
taccggcagatcctcggctgggcgcccagcaacgaacaggccctggccggcctgcaccgc
gtcgccagccagtaccgcgacctggccaacagcgcctaccggcgccgggatttccccgcc
gccctggcaatgatcgagcgcgggctgcaggccgagccggaaaaccccgaactgctgaag
atgcgcgacgagcaccaggagctgctggcctcggcgcgcgcggccagggcggcccagtcc
agccggcccgtacagcggacctcggcgccgcccagcgagccgcccgtcgagaacggcaac
ccgatcaagcgggcctggaacaacctattcggcaactga

KEGG   Azotobacter chroococcum: Achr_40580
Entry
Achr_40580        CDS       T03640                                 
Name
(GenBank) Serine/threonine protein kinase PpkA related protein
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_40580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acx01001]
    Achr_40580
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_40580
Enzymes [BR:acx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Achr_40580
Protein kinases [BR:acx01001]
 Serine/threonine kinases: Other
  Bacterial family
   Achr_40580
Secretion system [BR:acx02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Achr_40580
SSDB
Motif
Pfam: VWA_2 VWA
Other DBs
NCBI-ProteinID: AJE23443
UniProt: A0A0C4WKT3
LinkDB
Position
complement(4564058..4566037)
AA seq 659 aa
MWHEMAVLGGLLLAASAAPALAADDRPLLQAGKKTLYQRVLTTPSCRLGDQPGAAGGKPQ
PAFTRFYVYQRQQVGDGEWLKVGADSYGKTLGWIDGGCAVEWKMQMTLALTNPAGRDPLL
FFRQRESLDKLFAAGDPGKLLKPIRANLASQGRDPSVVAREPDYAVDLAKRFYLLPVLNA
REIMTEKGFRVRELEVASVTAAAPKSAEQTAQDKAGEVNTLKGFSAAVVFVIDSTISMGP
YIDRTREAIRKIYQHIEQEKLLKQVKFGLVAYRSNVKAVPALEYVSKLYVDPAQVQGGED
FLARMAALKPATVSSSRFDEDAYAGVMKALDGIDWTQFGARYIVLVSDAGALDGSDPLSA
TGLDAAQVRLEAKHRGVAIYSLHLKTPSGASNHASAEAQYRDLSNNPVLNKPLYYPVDAG
DVDNFGRKIDGLAAAITGQVKAAYRGEMAAGSALGADADYGKKGKPADDALLEDTAKLGH
AMRLAYLGEVTGASAPPVFNAWISDRDFVKQNVPTTEVRVLLTKAQLSDLAEVVKKIADA
ANEGLISPNEMFERLRSVAATMGKDPSQLQKGGKSATLAEMGLMAEYLEGLPYLSEVLSL
DEETWKGMEGLEQEKFIRRLNTKLKYYQKYNADADRWVSLAEGSDPRDHVYPVPLEALP
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgtggcacgagatggcggtgctcggcggcctgctgctggccgccagcgccgctccggcg
ctggcggccgacgacaggcccctgctgcaggccggcaagaagaccctctaccagcgcgtg
ctgaccacccccagctgccgcctcggcgaccagcccggcgcggccggcggcaagccgcaa
ccggccttcacccgcttctacgtgtaccagcggcagcaggtcggcgacggcgaatggctg
aaggtcggcgcggacagctacggcaagaccctcggctggatcgacggcggctgcgcggtg
gagtggaagatgcagatgaccctggcgctgaccaacccggccggccgcgatccgctgctg
ttcttccgccagcgcgagagtctcgacaagctgttcgccgcgggcgaccccggcaagctg
ctcaagccgatccgcgccaacctggccagccagggccgcgatccctccgtggtcgcccgc
gagccggattatgccgtcgacctggccaagcgcttctacctgctgccggtgctgaacgcc
cgggaaatcatgaccgagaagggcttccgggtgcgcgagctggaagtcgcctcggtgacc
gccgccgcgccgaagagcgccgagcagaccgcccaggacaaggccggcgaggtgaacacc
ctgaagggcttcagcgccgccgtggtgttcgtcatcgactcgaccatctccatggggccg
tacatcgaccgcacccgcgaggcgatcaggaagatctaccagcacatcgagcaggaaaag
ctgctcaagcaggtcaagttcggcctggtcgcctaccgctccaacgtcaaggccgtgccg
gcgctggagtacgtcagcaagctgtacgtcgatccggcccaggtgcagggcggcgaggac
ttccttgcccggatggccgcgctgaagccggccacggtatccagcagccgcttcgacgag
gacgcctacgccggggtcatgaaggccctggacggcatcgactggacccagttcggcgcc
cgctacatcgtgctggtcagcgatgccggcgcgctggacggcagtgacccgctgtccgcc
accggcctcgacgccgcccaggtgcgcctggaggccaagcaccgcggcgtggccatctac
agcctgcacctgaagaccccgagcggggcgagcaaccatgcctccgccgaggcgcagtac
cgcgacctgtcgaacaaccccgtcctcaacaagccgctgtactacccggtggacgccggc
gatgtggataacttcggccgcaagatcgacggtctggccgccgccatcaccggccaggtc
aaggccgcctaccgcggcgaaatggccgccggcagcgccctcggcgccgacgccgactat
ggcaagaagggcaagccggccgacgacgccctgctggaagacaccgccaagctcggccac
gccatgcgcctggcgtacctcggcgaagtcaccggggccagcgcgccgccggtgttcaac
gcctggatcagcgaccgcgacttcgtcaaacagaacgtgccgaccaccgaggtccgcgtg
ctgctgaccaaggcccagctcagcgacctcgcggaggtggtgaagaagatcgccgacgcc
gccaacgagggcctgatctcgcccaacgagatgttcgagcgcctgcgctcggtggccgcg
accatgggcaaggaccccagccagctgcagaagggcggcaagtccgccaccctggccgag
atgggcctgatggccgagtacctggagggcctgccgtacctcagcgaggtgctcagcctc
gacgaggagacctggaagggcatggaggggctggagcaggagaaattcatccgccggctg
aacaccaagctcaagtactaccagaagtacaacgccgacgccgaccgctgggtgtcgttg
gccgagggcagcgatccgcgggatcatgtgtatccggtgcccttggaggcgttgccttga

DBGET integrated database retrieval system