KEGG   Azotobacter chroococcum: Achr_24580
Entry
Achr_24580        CDS       T03640                                 
Symbol
pheT
Name
(GenBank) phenylalanyl-tRNA synthetase subunit beta
  KO
K01890  phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_24580 (pheT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acx01007]
    Achr_24580 (pheT)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acx03016]
    Achr_24580 (pheT)
Enzymes [BR:acx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     Achr_24580 (pheT)
Amino acid related enzymes [BR:acx01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   Achr_24580 (pheT)
Transfer RNA biogenesis [BR:acx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Achr_24580 (pheT)
 Prokaryotic type
    Achr_24580 (pheT)
SSDB
Motif
Pfam: B3_4 tRNA_synthFbeta FDX-ACB tRNA_bind B5 Dsc3_N
Other DBs
NCBI-ProteinID: AJE21893
UniProt: A0A0C4WIE8
LinkDB
Position
complement(2758724..2761102)
AA seq 792 aa
MKFSEQWLRDWVNPQVSRDELVARLSMAGLEVDSVTPVAGAFSGVVVGEILATEPHPDAD
KLRVCQVSNGSETFQVVCGAPNARPGIRIPFAMLGAVLGDDFKIKKAKLRGVESFGMLCS
AAELKVSEESDGLLELPVDAPLGQDIRTCLNLDDASIEVDLTPNRGDCLSLAGLAREVGA
LYGAPVTRPSIASVPPLHDEVRPVEVLASQACPRYLGRVVRNVDLSRPTPQWMVERLRRS
DIRAIDPAVDVTNYVMLELGQPMHAFDLAELRGGIRVRMAEEGEKLVLLDGQEVSLRADT
LVIADHERALAIAGVMGGEHSGVAAGTRDLFLESAFFDTIAIAGKARSYGLHTDASHRFE
RGVDWQLAREAMERATALLLEIVGGEPGPIVEVADPASLPQVAPITLRAERIEQMLGLRM
EAAEVERLLVALGLTVSSAAAGQWQIEVPSHRFDISLEVDLIEELGRLHGYNNLPVRYPQ
ARLAPQARAEARGELPVLRRLLVARGYQEAITYSFIDPRLFELFTPGVEPLTLANPISAD
MAAMRASLWPGLAKALQHNLNRQQSRVRLFESGLRFVGQLDNLKQEPVLAGAITGSRLPE
SWSHDRDAVDFYDAKADVEALLAAAGAADEYRFVSGEHPALHPGQTARIERDGRLVGFLG
ALHPELGKALGLDQPVFLFELVLAEIAAGRLPAFRELSRFPEVRRDLALIVDRETPAAAL
LQSIREAAGEYLSDLRLFDVYQGKGIDPQRKSLAVGLTWQHPSRTLNDDEVNSTTQNILT
SLEERFNATLRK
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgaaattcagcgaacaatggctgcgggactgggtcaacccgcaggtgtcccgcgacgaa
ctggtggcccgcctgtccatggctggtcttgaggtcgacagcgtcacgccggtggccggc
gctttttccggcgtggtggtgggcgagatccttgccaccgagccgcacccggacgccgac
aagctgcgcgtctgtcaggtgagcaacggcagcgaaaccttccaggtggtctgtggtgcg
cccaacgcccgtccgggcatcagaatcccctttgccatgctcggtgccgtgctcggtgac
gatttcaagatcaagaaggccaagctgcgtggcgtggagtccttcggcatgctctgctcg
gcagccgagctcaaggtcagcgaggagagcgacggcctgctggagctgccggtcgatgcg
ccgctggggcaggacattcgcacctgtctcaacctggacgatgccagcatcgaggtggac
ctgacccccaaccgtggcgactgcctgtccctggccggcctggcccgcgaggtaggcgcc
ctctacggcgctccggtcactcgtccgtcgatcgccagcgtgccgccgctacatgacgaa
gtgcgtccggtcgaggtgctggcgtcccaggcctgcccgcgctatctcggccgcgtggtg
cgcaacgtcgacctgtcgcggccgaccccgcagtggatggtcgaacgcctgcgccgctcc
gatatccgcgccatcgacccggcggtcgacgtcaccaactacgtgatgctcgagctgggc
cagccgatgcatgccttcgatctcgccgagctccgtggcggcatccgcgtgcgcatggcc
gaggagggcgagaaactggtcctgcttgacggccaggaagtcagcctgcgcgccgatacc
ctggtgatcgccgaccacgagcgcgctctggccatcgccggcgtgatgggcggcgaacac
agcggcgttgccgccggtacccgcgatctgttcctcgaaagcgccttcttcgacaccatt
gccatcgctggcaaggcccgttcctacggtctgcacaccgacgcctcgcaccgcttcgaa
cgtggcgtcgactggcagctggcccgcgaagccatggagcgtgccaccgcgctgctgctg
gagatcgtcggcggagagcccggtcccatcgtcgaggtagccgatccggcgagcctgccg
caggtggcaccgatcaccctgcgcgccgagcgcatcgagcagatgctcggtctgcgcatg
gaggctgccgaagtcgagcgcctgctggtcgcgctgggactgacagtcagctcggctgcg
gctggccagtggcagatcgaggtgcccagccatcgtttcgatatcagcctcgaagtggat
ctgatcgaggagctcggccgcctgcatggttacaacaacctgccggtccgttatccgcag
gcacgcctggccccgcaggcacgtgccgaagctcgcggcgaactgccggtgctgcgccgg
ctgctggtcgcgcgcggctaccaggaggcgatcacctacagcttcatcgatcccaggctg
ttcgagcttttcactccgggcgtcgagccgctgaccctggccaatccgatctccgcggat
atggcggccatgcgggcctcgctctggccgggactggccaaggcgttgcagcacaacctg
aatcgccagcagtcccgcgtgcgtctgttcgagagcggcctgcgtttcgtcggtcagctg
gacaacctcaagcaggagcccgtgctggctggcgccatcaccggcagccgcctgccggag
agctggagccatgaccgggatgcggtggacttctacgatgccaaggcggatgtggaggcc
ctgcttgccgccgccggcgcggcggacgaataccgtttcgtcagtggcgagcatcccgcg
ctacatcctgggcagacggcgcggatcgagcgcgatgggcgtctggtcggcttcctgggg
gctctgcatcccgagctgggcaaggcgctggggctggatcagccggtcttcctgttcgaa
ctggtcctggcggaaatcgccgccggtcgtttgccggcctttcgcgaactctcgcgtttc
cctgaagtgcgccgcgatctggccctgatcgtcgatcgtgaaacaccggccgcagcattg
ctgcagagcattcgcgaggcggcgggggaatacctgtccgaccttcggctgtttgacgtc
tatcagggtaaaggcattgatccgcaacgaaaaagcttggccgtcggcttgacctggcaa
catccatcgcgcactcttaacgatgatgaggtgaacagtacaacccagaacatcctcacc
tcgctggaagaaaggttcaacgcgacgttaaggaagtag

KEGG   Azotobacter chroococcum: Achr_24590
Entry
Achr_24590        CDS       T03640                                 
Symbol
pheS
Name
(GenBank) phenylalanyl-tRNA synthetase subunit alpha
  KO
K01889  phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_24590 (pheS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acx01007]
    Achr_24590 (pheS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acx03016]
    Achr_24590 (pheS)
Enzymes [BR:acx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     Achr_24590 (pheS)
Amino acid related enzymes [BR:acx01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   Achr_24590 (pheS)
Transfer RNA biogenesis [BR:acx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Achr_24590 (pheS)
 Prokaryotic type
    Achr_24590 (pheS)
SSDB
Motif
Pfam: tRNA-synt_2d Phe_tRNA-synt_N Prok-RING_2 tRNA_synthFbeta
Other DBs
NCBI-ProteinID: AJE21894
UniProt: A0A0C4WN15
LinkDB
Position
complement(2761139..2762155)
AA seq 338 aa
MENLDALVSQALEAVQHCEDVNALEQLRVHYLGKKGELTQLMQTLGKLSAEERPKAGALI
NAAKSSVQEALNARKADLESAALAARLAAERIDVTLPGRGQASGGLHPVTRTLERVEQFF
THIGYSVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMES
RQPPIRIVCPGRVYRCDSDITHSPMFHQLEGLLIDENVSFADLKGTIEEFLRVFFEKPLG
VRFRPSFFPFTEPSAEVDMQCVMCGGHGCRVCKHTGWLEVMGCGMVHPNVLRMSGIDPEK
YQGFAFGMGIERLAMLRYGVNDLRLFFDNDLRFLAQFR
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggaaaacctggatgcactggtctcgcaagcgctcgaggccgtgcaacattgcgaagac
gtcaacgccctggagcagctccgggtccactacctcggcaagaagggcgagctgacccag
ctgatgcagaccctgggcaagctctcggccgaggagcggccgaaggccggagccctgatc
aatgctgccaagagcagcgttcaggaggccctcaatgcgcgcaaggccgacctcgagtcc
gccgcgctggctgccaggctggccgccgagcgcattgacgtgaccctgccggggcgtggc
caggcttccggcggcctgcatccagtgacccgtaccctcgagcgcgtcgagcagttcttc
acccatatcggctacagcgtcgccgagggcccggaagttgaggacgattaccacaacttc
gaggccctcaacatccccggccaccatccggcgcgggcgatgcacgataccttctacttc
aatgccaacatgctgctgcgtacccacacctcgccggtccaggtgcgcaccatggaaagc
cgccagccgccgatccgcatcgtctgcccgggccgcgtttaccgctgcgactcggatatc
acccactcgccgatgttccaccagctcgaaggcctgctgatcgacgaaaacgtcagcttc
gccgacctcaagggcaccatcgaggagtttctccgggtgttcttcgagaagccgctgggc
gtacgtttccgcccctcgttcttccccttcaccgaaccctcggccgaggtcgacatgcag
tgcgtgatgtgcggcggccacggttgccgggtgtgcaagcacaccggctggctggaggtg
atgggctgcggcatggtgcaccccaacgtgctgcgcatgtccggcatcgatccggagaag
taccagggcttcgccttcggcatggggatcgagcgcctggccatgttgcgttatggcgtc
aacgatctgcgcctgttcttcgacaacgatctgcgcttcctcgcgcaattccgctag

DBGET integrated database retrieval system