KEGG   Azotobacter chroococcum: Achr_28960
Entry
Achr_28960        CDS       T03640                                 
Symbol
lepB
Name
(GenBank) signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
acx  Azotobacter chroococcum
Pathway
acx03060  Protein export
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_28960 (lepB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acx01002]
    Achr_28960 (lepB)
Enzymes [BR:acx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     Achr_28960 (lepB)
Peptidases and inhibitors [BR:acx01002]
 Serine peptidases
  Family S26: signal peptidase I family
   Achr_28960 (lepB)
SSDB
Motif
Pfam: Peptidase_S26 DUF5115 Peptidase_S24
Other DBs
NCBI-ProteinID: AJE22311
UniProt: A0A0C4WP01
LinkDB
Position
complement(3261013..3261864)
AA seq 283 aa
MSINFPLLLVLAVLVSGALALLDLIVLAPRRRAAVASYEGSVGQPDQSVLERLSKEPLLV
EYGKSFFPVLAIVLVLRSFLVEPFQIPSGSMKPTLEVGDFILVNKFAYGIRLPVLDTKVI
EVGEPQRGDVMVFRYPSDPSINYIKRVVGLPGDHIRYGSDKRLFVNGAPVAEQLLGKASG
VLGSAVLYKEQLGDVEHLIRKETRRHAEPSREWVVPEGHYFMMGDNRDNSNDSRYWNDPQ
LVDEMQGMVPDENIVGKAFAVWMSWPEPKLQNLPNFSRVGLIH
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtcgatcaatttccccctgttgctggtgctggcggtgctggtcagcggtgcgttggcc
ctgctggatctgatcgtgctggcgccgcgccggcgggcagcggttgcctcctatgagggc
agtgtcggccaacccgaccagagcgtgctggaacgcctgagcaaggagccgctgctggtc
gagtacggcaagtcgttcttcccggtcctggcgatagtgctggtgctgcgctcctttctc
gtggagcccttccagattccctcgggctcgatgaaacccaccctggaggtgggggacttc
attctggtgaacaagttcgcctatggcatccgcctgcccgtgctggacaccaaggtcatc
gaggtgggtgagccgcagcgtggcgatgtcatggtatttcgctacccgagtgatccgagc
atcaactacatcaagcgggtggtcggcctgcccggtgaccatatccgctatggcagcgac
aagcgcctgttcgtcaatggagcaccggttgccgaacagttgctgggcaaggcgtcggga
gttctgggcagtgcagtgctgtacaaggagcagctcggcgatgtcgagcatctgatccgc
aaggaaacgagacgccatgccgagccctcgcgcgaatgggtcgtgccggaaggccactat
ttcatgatgggcgacaaccgcgacaactccaacgacagtcgctactggaatgacccccag
cttgttgacgagatgcagggcatggttccggacgagaacatcgttggcaaggccttcgct
gtctggatgagctggccggagcccaagctgcagaatctgccgaatttctctcgtgttggc
ctgatccactga

DBGET integrated database retrieval system