KEGG   Azotobacter chroococcum: Achr_29320
Entry
Achr_29320        CDS       T03640                                 
Symbol
secA
Name
(GenBank) preprotein translocase subunit SecA
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_29320 (secA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_29320 (secA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_29320 (secA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_29320 (secA)
Enzymes [BR:acx01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Achr_29320 (secA)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_29320 (secA)
SSDB
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C Helicase_C DEAD
Other DBs
NCBI-ProteinID: AJE22346
UniProt: A0A0C4WP28
LinkDB
Position
complement(3298541..3301285)
AA seq 914 aa
MFAPLLRVLFGSKNDREVKRMRRAVRAINALEEQMVALTDEQLRTRTEEFRERLGKGETL
DQLLPEAFAVAREAGKRVMGMRHFDVQLIGAMVLHEGKIAEMRTGEGKTLVATLAVYLNA
LAGKGVHVVTVNDYLARRDANWMRPLYEFLGLSVGVVTPFQPPEEKRAAYAADITYGTNN
EFGFDYLRDNMAFSLEDKFQRELNYAVIDEVDSILIDEARTPLIISGQAEDSSQLYLQIN
ALIPQLKRHIEEEEGVVTQEGHYSVDEKTRQIELNEQGHQFIEELLTRVGLLPEGDNLYS
AHNLPLLTHVYAGLRAHVLFHRNVEYIVQGNQVLLIDEHTGRTMPGRRLSEGLHQAIEAK
EGLPIQAESQTLASTTFQNYFRLYHKLAGMTGTADTEAFEFRQIYGLDVVVIPTHRPIAR
KDFNDLVYLTQEEKYAAIIADIKECQAQGRPVLVGTASIESSEYVSQLLKKEGIAHQVLN
AKYHEKEAEIIAQAGRPGAVTIATNMAGRGTDILLGGNWEVEVASLGEPGEEQVAQIKAD
WQKRHQQVIESGGLHVIASERHESRRIDNQLRGRSGRQGDPGSSRFYLSLEDNLMRIFAS
DRVKNFMKALGMQSGEAIEHRMVTNAIEKAQRKVEGRNFDMRKQLLEFDDVANEQRKVIY
HMRNNLLVAEDIGETIAEFREEVLGAAIDQHIPPQSLPEQWDIAGLEAALQGDFGVQLPL
QQWLDEDDRLHEEALRERILEALLAAYREKEEIAGAEALRTFEKQILLRVLDDLWKDHLS
TMDHLRHGIHLRGYAQKNPKQEYKRESFELFQSLLESIKRDAIRVLSHVQVRREDPAEEE
ERLRREAEALARRMQFQHATASALAPQTEDGDLEVVEEPQAGAVPVRPEPKIGRNEPCPC
GSGKKYKHCHGQLN
NT seq 2745 nt   +upstreamnt  +downstreamnt
atgtttgcgcctttgttgagagtgctctttggaagcaagaacgatcgtgaagtcaaacgc
atgcgtcgagccgtgcgggcgatcaatgccctcgaagagcagatggtggcgctgacggac
gagcagctgcgcaccaggaccgaggagttcagggagcgtctcggcaagggcgaaaccctc
gaccagctgttgccggaggccttcgccgtcgcccgcgaagcgggcaagcgggtgatgggt
atgcgccacttcgatgtgcagctgatcggtgccatggttctgcacgaaggcaagatcgcc
gagatgcgcaccggtgaaggcaagaccctggtggcgaccctggccgtctatctcaatgct
ctggccggcaagggcgtgcacgtggtgacggtgaacgactacctggcccgccgcgacgcc
aactggatgcgcccgctgtacgagtttctcggtctttccgtcggcgtggtcacgcccttc
cagccgccggaggagaagcgcgccgcctacgctgccgacatcacctacggcaccaacaac
gagttcggcttcgactacctgcgcgacaacatggccttcagcctggaggacaagttccag
cgcgaactcaactatgcggtgatcgacgaggtcgactccatcctgatcgacgaggcgcgc
acgccgttgatcatttccggccaggccgaggacagctcccagctgtacctgcagatcaac
gccctgattccgcagctgaagcgccacatcgaggaagaggagggtgtggtcacccaggag
gggcactacagcgtcgacgagaagacccggcagatcgagctgaacgagcagggccaccag
ttcatcgaggagctgctgacccgcgtcggcctgctgcccgagggcgacaacctctactcc
gctcacaacctgccgctgctgacccatgtctatgcaggcctgcgcgcgcacgtcctgttc
catcgcaacgtcgagtacatcgtgcagggcaaccaggtgctgctgatcgacgagcacacc
ggccggaccatgcccggccgccgcctctccgaggggctgcaccaggccatcgaggccaag
gaggggctgccgatccaggcggaaagccagactctggcctcgaccaccttccagaactac
ttccgcctctaccacaagctcgccggcatgaccggcaccgccgacaccgaggccttcgag
ttccgccagatctacggtctcgacgtggtggtgatcccgacccaccggccgatcgcgcgc
aaggacttcaacgacctagtctacctgacccaggaagagaagtacgcggcgattatcgcc
gatatcaaggagtgccaggcccaggggcgcccggttctggttgggaccgcctcgatcgag
agttccgaatacgtttcccagctgctgaagaaggaaggtatcgcgcaccaggtgctcaat
gccaagtatcacgagaaggaagccgagatcatcgcccaggccggtcgtcccggtgcggtg
accatcgccaccaacatggccggccggggtacggacatcctcctcggcggcaactgggag
gtcgaggtcgcgtcgctgggcgagccgggcgaagagcaggtcgcgcagatcaaggccgac
tggcagaagcgccaccagcaggtgatcgagtccggcggactgcatgtgatcgcctccgag
cgccatgagtcccggcgcatcgacaaccagctgcgcggccggtccggccgtcagggcgac
ccgggctccagccgcttctacctgtccctggaagacaatctgatgcgcatcttcgcctcc
gaccgggtgaagaacttcatgaaggcgctcggcatgcagtccggtgaggccatcgagcac
cgcatggtgaccaatgccatcgagaaggcccagcgcaaggtcgagggccgcaacttcgac
atgcgcaagcagctgctcgaattcgacgacgtggccaacgagcagcgcaaggtgatctac
cacatgcgcaacaacctgctggtggccgaggacatcggcgaaaccatcgccgaattccgc
gaggaggtgctgggcgccgccatcgaccagcacattccgccgcagtcgctgcccgagcag
tgggacatcgccggtctggaagccgccctgcagggtgatttcggcgtgcagctgccgttg
cagcaatggctcgacgaggacgacaggctccatgaggaggcgttgcgcgagcgcatcctc
gaggcgctgctggcggcctaccgggagaaggaggagatcgctggcgccgaagccttgcgc
accttcgagaagcagatcctgctgcgcgtgctggacgacctgtggaaggatcatctgtcg
accatggatcacctgcgccacggcatccacctgcgcggctacgcgcagaagaatcccaag
caggaatacaagcgcgagtccttcgagctgttccagtccctgcttgagtcgatcaagcgc
gatgccatccgcgtgctctcccatgtgcaggtccgccgcgaggatccggccgaggaagag
gagcgtctgcgccgcgaggccgaggccctggcccggcgcatgcagttccagcatgccact
gcttcggccctggccccgcagacggaggacggcgacctcgaggtcgtcgaggagccccag
gcgggcgccgtgccggtgcgccccgagccgaagatcgggcgcaacgagccctgtccctgc
gggtccggcaagaagtacaagcactgccacgggcagctcaactag

DBGET integrated database retrieval system