KEGG   Azotobacter chroococcum: Achr_29670
Entry
Achr_29670        CDS       T03640                                 
Symbol
trpS
Name
(GenBank) tryptophanyl-tRNA synthetase
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_29670 (trpS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acx01007]
    Achr_29670 (trpS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acx03016]
    Achr_29670 (trpS)
Enzymes [BR:acx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     Achr_29670 (trpS)
Amino acid related enzymes [BR:acx01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Achr_29670 (trpS)
Transfer RNA biogenesis [BR:acx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Achr_29670 (trpS)
 Prokaryotic type
    Achr_29670 (trpS)
SSDB
Motif
Pfam: tRNA-synt_1b DUF1508 tRNA-synt_1f
Other DBs
NCBI-ProteinID: AJE22380
UniProt: A0A0C4WS06
LinkDB
Position
complement(3334570..3335931)
AA seq 453 aa
MTTRILTGITTTGTPHLGNYAGAIRPAIVASRDPHADSFYFLADYHALIKCDDPERIQRS
RLEIAATWLACGLDAEKTTFYRQSDIPEITELTWLLTCVTAKGLLNRAHAYKASVDKNLE
VGEDPDAGVTMGLFSYPVLMAADILMFNANKVPVGRDQIQHVEMARDIGQRFNHLFGRGS
EFFTLPEAVVEAEVATLPGLDGRKMSKSYDNTIPLFGSARQLKDAIARIITDSREPGEPK
DPDSSHLFTLYQAFAAPEQLAGFRADLLAGLAWGEAKQRLLQLLENELGEARERYQTLIA
RPLDLEDILQAGAAKARRIATPFLGELREAVGLRSFRSDVRSQAASGKKKAAKAARFVSF
RESDGRFRFRFLAADGEELLLSRPFDDPKAVGRISQRLIALGPDALELRADEGAQFSLWL
DGECMADSPVYADPDALEAAMLRLREAIAGLAD
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaccactcgaatcctcaccggtatcaccaccaccggcactccgcatctcggcaactac
gctggcgccatccgcccggcgatcgttgccagtcgcgacccccatgccgactcgttctat
ttcctcgccgactaccatgcgttgatcaagtgcgacgacccggagcgcattcagcgctcg
cgtctggaaatcgccgccacctggttggcctgcgggctggacgcggagaagacgaccttc
taccgccagtcggacattcccgagataaccgagctgacctggctgctcacctgcgtgacg
gccaagggtctgctcaaccgtgcgcatgcctacaaggcctcggtggacaagaatcttgag
gtcggcgaggatcccgatgccggggtgaccatggggctgttcagctatccggtgctgatg
gcggcagatatcctgatgttcaacgcgaacaaggtgccggtcggtcgcgaccagatccag
cacgtggagatggcgcgtgatatcgggcagcgcttcaatcatctgtttggccggggtagt
gagttcttcacccttccggaggcggtggtcgaggcggaggtcgccaccctaccggggctc
gacggccgtaagatgtcgaagagctatgacaataccattcctctgttcggctcggcccgt
cagttgaaggatgccatcgctcgcatcatcaccgattcgcgagagccgggtgagccgaag
gatccggacagctcgcatctgttcacgctctaccaggcgttcgccgcgcccgagcaactc
gccggattccgtgccgatctgcttgccggtctggcctggggggaggccaagcagcgcctg
ctccagttgctggaaaacgaattgggtgaagctcgcgagcgctaccaaacgctgattgcg
agaccacttgacttggaggacattctccaggctggtgcggccaaagcgcgcaggatcgcc
acccccttcctcggcgagctgcgcgaagcggttggattgcgctcgttccgtagcgacgtg
cgtagtcaggctgccagcggcaagaagaaagcggcaaaagccgcgcgtttcgtcagtttc
cgcgaatccgatggaaggtttcgtttccgtttcctggctgccgatggcgaggagttgctg
ttgtcgcggccgtttgacgatcccaaggcggtggggcggatcagccagcggttgattgct
ctggggccggatgcgctcgaattgcgtgccgatgagggcgcccagttcagtctctggctg
gacggcgaatgcatggccgacagtccggtgtatgccgatccggatgccttggaggcagcc
atgctgcgcctgcgggaagcgattgcagggcttgccgactga

DBGET integrated database retrieval system