KEGG   Azotobacter chroococcum: Achr_29910
Entry
Achr_29910        CDS       T03640                                 
Symbol
ptsN
Name
(GenBank) PTS IIA-like nitrogen-regulatory protein
  KO
K02806  nitrogen PTS system EIIA component [EC:2.7.1.-]
Organism
acx  Azotobacter chroococcum
Pathway
acx02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Achr_29910 (ptsN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_29910 (ptsN)
Enzymes [BR:acx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-
     Achr_29910 (ptsN)
Transporters [BR:acx02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Nitrogen regulatory II component
    Achr_29910 (ptsN)
SSDB
Motif
Pfam: PTS_EIIA_2 Band_3_cyto
Other DBs
NCBI-ProteinID: AJE22404
UniProt: A0A0C4WP76
LinkDB
Position
3356185..3356649
AA seq 154 aa
MIRLEDILTPGRSLVNVPGGSKKRALEYIANLVAREMPDLDQQTIFESLIAREKLGSTGF
GNGIAIPHCRLPGCPAPISVLLRLEAPIDFDAIDGAPVDLLFVLLVPEAATDEHLQLLRQ
IASMLDRGEIRERLRQVESSEALYQVVSDAQKGQ
NT seq 465 nt   +upstreamnt  +downstreamnt
atgatcagactcgaagacatcctgactcccggccgttccctggtgaacgtgccgggaggc
agcaagaagcgcgctctcgaatacatcgccaatctggtcgcccgcgagatgcccgacctg
gatcagcagaccattttcgagagcctgattgcccgtgaaaaactgggttcgaccggtttt
ggcaatggcatcgccattccccattgccgtctgcccggttgccctgccccgatcagtgtc
ctgctccgtctggaggctccgatcgatttcgatgccatcgatggcgcaccggtcgacctg
ctgttcgtcctgctggttccggaggccgccaccgacgaacatctgcaattgcttcgtcag
atcgccagcatgctcgatcgcggcgagatacgcgaacgcctgcgccaggtcgagagcagc
gaagccctttaccaggtcgtgtcggacgcgcagaagggccagtag

DBGET integrated database retrieval system