KEGG   Azotobacter chroococcum: Achr_29930
Entry
Achr_29930        CDS       T03640                                 
Symbol
ptsO
Name
(GenBank) Phosphocarrier NPr protein
  KO
K02784  phosphocarrier protein HPr
Organism
acx  Azotobacter chroococcum
Pathway
acx02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Achr_29930 (ptsO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_29930 (ptsO)
Transporters [BR:acx02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8]
    Achr_29930 (ptsO)
SSDB
Motif
Pfam: PTS-HPr
Other DBs
NCBI-ProteinID: AJE22406
UniProt: A0A0C4WP74
LinkDB
Position
3357620..3357892
AA seq 90 aa
MPACEITIINKLGLHARAAAKFVGVAGRYACAVRIGRAPESLVDGKSIMAVMMLAAGKGT
PIHLHTEGEQDCEALEALIELINNRFDEDE
NT seq 273 nt   +upstreamnt  +downstreamnt
atgcccgcctgcgaaatcaccatcatcaacaagcttgggctgcatgcccgggcagcggcc
aagttcgtcggggtcgccgggcgctacgcctgtgcggtgcgcatcggccgagcgccggag
agcctggtcgacggcaagagcatcatggcggtcatgatgctggcagctggcaagggaacg
cccattcacctgcataccgaaggcgaacaggactgcgaggcgctggaggcactgatcgag
ctgatcaacaatcgcttcgacgaagacgaataa

KEGG   Azotobacter chroococcum: Achr_30310
Entry
Achr_30310        CDS       T03640                                 
Symbol
fruB
Name
(GenBank) fructose-specific multiphosphoryl transfer protein
  KO
K23993  multiphosphoryl transfer protein [EC:2.7.3.9 2.7.1.202]
Organism
acx  Azotobacter chroococcum
Pathway
acx02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Achr_30310 (fruB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_30310 (fruB)
Enzymes [BR:acx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     Achr_30310 (fruB)
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     Achr_30310 (fruB)
Transporters [BR:acx02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Multiphosphoryl transfer protein
    Achr_30310 (fruB)
SSDB
Motif
Pfam: PEP-utilizers_C PTS_EIIA_2 PEP-utilizers PEP-utilisers_N PTS-HPr
Other DBs
NCBI-ProteinID: AJE22444
UniProt: A0A0C4WPB2
LinkDB
Position
complement(3402544..3405420)
AA seq 958 aa
MLELNAAQIRMGRSAPDKQAALALLAEGLIDDGLVEPGYLAGMQAREAQGSTFLGQGIAI
PHGTPETRDQVRRTGVRLIQFPEGVDWGNGQQVYLAIAIAARSDEHLHLLQLLTRALGEG
DLSQALREAREAEQLVALLQGAPRELALDSQLIGLGVAAEEFDELVWHGARLLRRAGCVA
SGFAGSLLQGQPLPLGEGLWWLHSEQAVEQPGLAFVTPGQPLSLHGQPLAGLFCLASLGE
AHSQLLERLCDLLIEGRGATFSQATCSRAVLEALGAELPDDWPSLRVVLANAHGLHARPA
KALVEVAQAFEGEIRIRLAGETGRGVSAKSLSKLLALGARRGQELEFSAEPTIAADALTA
IEAAVLAGLGESIEPLAVHGETPSPEAAPSSSTFIRPQAPAAGARLQAVAAAPGIAIGPA
LVRTPLELDYPQRGQGMLVELQRLDSALAQVTADIQRLIDNSTEANIRDIFITHQAMLRD
PALREDVNARLADGFSAEAAWSVETEAAAQQQEALHDALLAERAADLRDIGRRVLAHLCG
VEAPREPDEPYILVMDEVAPSDVASLNRQRVAGILTARGGATAHSAIIARALGIPAIVGA
GEGVLALAQGTPLLLDGDHGVLRVAPDAQTLEQARREREANRLRRERAHAERMLPAVTRD
GHGVEVAANIGASAESAEAVELGAEGVGLLRTELVFMDHAQAPDQHAQEAEYRRVLDGLA
GRPLVVRTLDVGGDKPLPYWPMPAEENPFLGVRGIRLSLQRPDILETQLRALLASADGRP
LRIMFPMVGGVEEWRIARDLTLSLREEIPIADLQLGIMVEVPSAALLAPVLAREVDFFSI
GTNDLTQYTMAIDRGHPTLSAQADGLHPSVLRLIGLTVEAAHAEGKWVGVCGELASDMLA
VPLLVGLGVDELSVSARAIALVKARVRELDFAHSRALAQQALALESAGAVRDLVGETH
NT seq 2877 nt   +upstreamnt  +downstreamnt
atgctcgagttgaatgccgcgcagattcgcatgggccgcagcgcgccggacaagcaggcg
gcgctggcgctgctcgccgagggcctgatcgacgacgggctggtcgagcccggctacctc
gccggcatgcaggcccgcgaggcccagggctcgaccttcctcggccagggcatcgcgatt
ccccacggcacgccggaaacccgcgaccaggtgcggcgcaccggcgtgcgcctgatccag
tttcccgagggcgtggactggggcaacggccagcaggtctacctggcgatcgccatcgcc
gcccgctctgacgagcacctgcacctgctgcagctgctgacccgggcgctcggcgagggc
gatctcagccaggcgctgcgcgaggcccgcgaggccgagcagctcgtcgcgctgctgcag
ggcgcgccgcgcgagttggccctggacagccagctgatcggcctgggcgtggccgccgag
gagttcgacgaactggtctggcacggcgcgcgcctcctgaggcgggccggctgcgtggcc
tccggcttcgccggcagcctgctgcagggccagccgctgccgctgggcgaggggctctgg
tggctgcacagcgagcaggcggtggagcagcccggactggccttcgtcaccccggggcag
ccgctcagcctgcacggccagccgctggccgggctgttctgcctggccagcctgggcgag
gcgcacagccaactgctcgagcggctctgcgacctgctgatcgaggggcgcggcgcgacc
ttcagccaggccacctgcagccgcgccgtgctggaggccctgggcgccgagctgccggac
gactggccgagcctgcgtgtggtcctggccaatgcccacggcctgcacgcgcgaccggcc
aaggcgctggtcgaggtcgcccaggccttcgagggcgagatccgcatccgcctggccggc
gaaaccggccgcggggtgtcggccaagagcctgagcaagctgctggccctcggcgcgcgg
cgcggccaggagctggagttcagcgccgagccgacgatcgccgccgatgccctgacggcc
atcgaggcggccgtgctggccggcctcggcgagagtatcgagcccctggcggtgcacggc
gagacgccgtcgcccgaggcggcgccgagtagctccaccttcatccggccgcaggcgccg
gcggccggagcgcgcctgcaggcggtcgccgcggcgccgggcatcgccatcggcccggcg
ctggtgcgcacgccgctggagctcgactatccgcaacgcggccagggcatgctggtcgag
ctgcaacgcctggacagcgccctggcgcaggtcaccgcggacatccagcggctgatcgac
aacagcacggaagccaacatccgcgacatcttcatcacccaccaggcgatgctgcgcgac
ccggcgctgcgcgaggacgtcaatgcgcgcctggccgacggcttcagcgccgaggccgcc
tggagcgtggaaaccgaggcggcggcgcagcagcaggaggccctgcacgatgcgctgctc
gccgagcgcgccgccgacctgcgcgacatcggccggcgggtgctggcgcacctgtgtggc
gtcgaggcgccgcgcgagccggacgagccctacatcctggtgatggacgaggtggcgccc
tccgacgtggccagcctcaatcgccagcgggtggccggcatcctcaccgcccgcggcggc
gccaccgcgcacagcgcgatcatcgcccgcgccctggggattcccgccatcgtcggcgct
ggcgagggggtgctggcgctggcccagggtaccccgctgctgctcgacggcgaccacggc
gtgctgcgcgtcgcgccggatgcgcagaccctggaacaggcccggcgcgagcgtgaggcc
aaccggctgcgccgcgagcgcgcccatgccgagcgcatgctgccggcggtgacccgcgac
ggccacggggtggaagtggcggcgaacatcggcgccagcgccgagagcgccgaggcggtc
gagctgggcgccgagggcgtcggcctgctgcgcaccgagctggtgttcatggaccatgcc
caggcgccggatcagcacgcccaggaagccgaataccgccgcgtgctcgacgggctggcc
ggccggccgctggtggtgcgcaccctggacgtcggcggcgacaagccgttgccctactgg
ccgatgccggcggaggagaaccccttcctcggcgtgcgcggcatccgcctcagcctgcag
cgcccggacatcctggaaacccagctgcgtgcgctgctggcctcggccgacggccggccg
ctgcggatcatgttcccgatggtcggcggcgtcgaggagtggcgcatcgcccgcgacctg
accctgagcctgcgcgaggagatcccgatcgccgacctgcagctcggcatcatggtcgag
gtgccctcggcggcgctgctggccccggtgctggcccgcgaggtggatttcttcagtatc
ggcaccaacgacctgacccagtacaccatggccatcgaccgcggccatccgaccctgtcg
gcccaggccgacggcctgcatccctcggtgctgcggctgatcggcctgaccgtcgaggcg
gcccatgccgagggcaagtgggtcggcgtgtgcggcgagctggccagcgacatgctcgcc
gtgcccctgctggtcggcctcggggtggacgagctgagcgtctcggcgcgcgccatcgcc
ctggtcaaggcgcgggtgcgcgagctggacttcgcccacagccgggcgctggcgcaacag
gcgctggctctggaaagcgccggcgcggtgcgcgacctggtcggggagacgcattga

DBGET integrated database retrieval system