KEGG   Azotobacter chroococcum: Achr_30040
Entry
Achr_30040        CDS       T03640                                 
Symbol
gatC
Name
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
acx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_30040 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acx03029]
    Achr_30040 (gatC)
Enzymes [BR:acx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Achr_30040 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Achr_30040 (gatC)
Mitochondrial biogenesis [BR:acx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Achr_30040 (gatC)
SSDB
Motif
Pfam: Glu-tRNAGln
Other DBs
NCBI-ProteinID: AJE22417
UniProt: A0A0C4WV00
LinkDB
Position
3371079..3371366
AA seq 95 aa
MALERSDVEKIAHLARLGLDDAEIPRTTQTLNDILGLIDRMQAVDTHGIEPLAHPLEATQ
RLRPDEVTECDHRDAYQAIAPAVENGLYLVPKVIE
NT seq 288 nt   +upstreamnt  +downstreamnt
atggcgcttgaacgctccgacgtggaaaagatcgcccacctggcccgcctggggctggat
gatgccgagatcccacgcaccacccagaccctgaacgacatcctcggtctgatcgaccgg
atgcaggcggtcgacacccacggcatcgagcccctggcccaccccctggaggccacccag
cgcctgcgcccggacgaggtcaccgagtgcgaccaccgcgacgcctaccaggccatcgcc
ccggccgtggagaacggcctgtatctggttcccaaggtgatcgagtga

KEGG   Azotobacter chroococcum: Achr_30050
Entry
Achr_30050        CDS       T03640                                 
Symbol
gatA
Name
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
acx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_30050 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acx03029]
    Achr_30050 (gatA)
Enzymes [BR:acx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Achr_30050 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Achr_30050 (gatA)
Mitochondrial biogenesis [BR:acx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Achr_30050 (gatA)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AJE22418
UniProt: A0A0C4WJ02
LinkDB
Position
3371366..3372817
AA seq 483 aa
MHRLTLAQIARGLAAKDFSSVELTEALLTRIGALDPQLNSFITVTADQARAQAQAADARR
AAGESGALLGAPIAHKDLFCTQGVRTSCASKILDNFVAPYDATVVEKLAAAGCVSLGKLN
MDEFAMGSANESSHYGPVRNPWNTECVPGGSSGGSAAAVAARLIPAATGTDTGGSIRQPA
ALTNLTGLKPTYGRVSRWGMIAYASSLDQGGPLARSAEDCALLLGAMAGFDPKDSTCVDQ
PVEDYLAALNQPLAGLRIGLPREYFGAGLDPRLSDAVMACVEELKKLGATIKEIGLPNMQ
HAIPAYYVIAPAEASSNLSRFDGVRFGYRCENPQNLEDLYKRSRGEGFGAEVKRRIMVGT
YALSAGYYDAYYLKAQKIRRLIRSDFIAAFQEVDLILGPTTPNPAWKLGEKSSDPVAAYL
EDIYTITANLAGIPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNVAHQYQQATDWHQRAP
EGF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgcatcgactgactctggcgcaaatcgcccgcggcctggccgccaaggacttctcctcc
gtcgagctgaccgaggccctgctgacccgcatcggcgcgctcgacccgcagctcaacagc
ttcatcaccgtcaccgccgaccaggcccgcgctcaggcccaggccgccgacgcgcgccgc
gccgccggcgagagcggcgccctgctcggcgcgccgatcgcccacaaggacctgttctgc
acccagggcgtgcgcaccagctgcgcctcgaagatcctcgacaacttcgtcgcgccctac
gatgccaccgttgtggaaaagctcgccgccgccggctgcgtgagcctcggcaagctgaac
atggacgagttcgccatgggctcggccaacgaatccagccactacggcccggtgaggaac
ccctggaacaccgaatgcgtgcccggcggctccagtggcggctccgccgcggcggtggcg
gcgcggctgatcccggcggccaccggcaccgacaccggcggctcgatccgccagccggcg
gcgctgaccaacctcaccggcctcaagcccacctacggccgggtatcgcgctggggcatg
atcgcctacgcctccagcctcgaccagggcggcccactggcgcgcagcgccgaggactgc
gccctgctgctcggcgccatggccggcttcgacccgaaggactccacctgcgtcgatcag
ccggtagaggactacctggccgcgctgaaccagccgctggccggcctgcgcatcggcctg
ccgcgcgaatacttcggcgccggcctcgacccgcgcctgtccgatgcggtgatggcctgc
gtcgaggagttgaagaagctcggcgccacgatcaaggaaatcggcctgcccaacatgcag
catgcgattcccgcctactacgtgatcgcgcctgccgaggcctcctccaacctgtcgcgc
ttcgacggcgtgcgcttcggctaccgttgcgagaacccgcagaacctcgaggacctctac
aagcgctcgcgcggcgagggcttcggcgcggaagtgaagcgccgcatcatggtcggcacc
tacgccctctccgccggctactacgacgcctactacctcaaggcgcagaagattcgccgg
ctgatccgcagcgacttcatcgccgccttccaggaggtggacctgatcctcggcccgacc
acgccgaacccggcctggaagctcggcgagaagagcagcgacccggtcgccgcctatctt
gaggacatctacaccatcaccgccaacctcgccggcattcccggcctgtccatgccggcc
ggcttcgtcgacggcctgccggtgggcgtgcagctgctcgcgccctacttccaggaaggc
cgcctgctcaacgtcgcccaccagtaccagcaggcgaccgactggcatcaacgggcaccg
gaaggcttctga

KEGG   Azotobacter chroococcum: Achr_30060
Entry
Achr_30060        CDS       T03640                                 
Symbol
gatB
Name
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
acx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_30060 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acx03029]
    Achr_30060 (gatB)
Enzymes [BR:acx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Achr_30060 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Achr_30060 (gatB)
Mitochondrial biogenesis [BR:acx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Achr_30060 (gatB)
SSDB
Motif
Pfam: GatB_N GatB_Yqey
Other DBs
NCBI-ProteinID: AJE22419
UniProt: A0A0C4WP89
LinkDB
Position
3372829..3374277
AA seq 482 aa
MQWETVIGLEIHAQLATRSKIFSGSATTFGAEPNTQASLIDLGMPGTLPVLNQEAVRMAV
KFGLAIDAELGRSNVFARKNYFYPDLPKGYQTSQMDKPIVGKGHLDITLEDGTVKRIGIT
RAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALVRYL
GICDGNMAEGSLRCDCNVSVRPKGQEAFGTRAEIKNVNSFRFIERAINHEVQRQIELIED
GGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPCPDLLPVVIEPDFLDEVRAGLPELPG
EKRARFESQFGLSAYDASVLSASRELADYFEQVQTVCGDAKLAANWVMGELSSLLNKDNL
EIDRSPVSATQLGGLILRIKDNTISGKIAKMVFEALAAGEGASADAIIETKGLKQVTDSG
AIEAVLDEVLSANAAQVEQYRASDEAKRAKMFGFFVGQAMKASKGKANPGQVNELLKKKL
EG
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgcaatgggaaaccgtgatcgggctggaaatccacgcgcagctcgccacccgctcgaag
atcttctccggcagcgccaccaccttcggcgccgagcccaacacccaggccagcctgatc
gacctcggcatgcctggcaccctgccggtactcaaccaggaagccgtgcgcatggcggtg
aagttcggcctggcgatcgatgccgagctgggccgcagcaacgtcttcgcccgcaagaac
tacttctaccccgacctgcccaagggctaccagaccagccagatggacaagcccatcgtc
ggcaagggccatctggacatcaccctggaggacggcacggtcaagcgcatcggcatcacc
cgcgcgcacctggaagaggacgccggcaagagcctgcacgaggacttccacggcatgacc
ggcatcgacctcaaccgcgccggcacgccgctcctggagatcgtctccgagccggacatc
cgctcggccaaggaggcggtggcctacgtcaaggcgatccacgcgctggtccgctacctg
ggcatctgcgacggcaacatggccgaaggctcgctgcgctgcgactgcaacgtctcggtg
cggcccaagggccaggaagccttcggcacccgcgccgagatcaagaacgtcaactccttc
cgcttcatcgagcgcgcaatcaaccacgaggtgcaacggcagatcgagctgatcgaggac
ggcggcaaggtcgtccaggaaacccgcctgtacgacccgaacaaggacgagacccgctcc
atgcgcagcaaggaggaggccaacgactaccgctacttcccctgccccgacctgctgccg
gtagtgatcgagccggacttcctcgacgaggtgcgcgccggcctgccggagctgcccggc
gagaagcgcgcgcgcttcgagagccagttcggcctgtccgcctacgacgccagcgtactg
tccgccagccgcgagctggccgactacttcgagcaagtgcagaccgtctgcggcgacgcc
aagctggcggccaactgggtgatgggcgagctgtccagcctgctcaacaaggacaacctc
gagatcgaccggtcaccggtctccgccacgcagctgggcgggctgatcctgcgcatcaag
gacaacaccatctccggcaagatcgccaagatggtcttcgaggccctggccgccggcgaa
ggcgcctccgccgatgcgatcatcgagaccaagggcctcaagcaggtcaccgacagcggc
gccatcgaggccgtgctcgacgaggtgctgagcgccaacgccgcgcaggtcgaacagtac
cgcgccagcgacgaggccaagcgcgccaagatgttcggcttcttcgtcggccaggcgatg
aaggcctccaagggcaaggccaaccccggccaggtgaacgaactgctgaagaagaagctc
gaaggctga

DBGET integrated database retrieval system