KEGG   Azotobacter chroococcum: Achr_30130
Entry
Achr_30130        CDS       T03640                                 
Name
(GenBank) Dipeptide ABC transporter, periplasmic substrate-binding component
  KO
K12368  dipeptide transport system substrate-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_30130
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Achr_30130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_30130
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Dipeptide transporter
    Achr_30130
SSDB
Motif
Pfam: SBP_bac_5
Other DBs
NCBI-ProteinID: AJE22426
UniProt: A0A0C4WP90
LinkDB
Position
3379659..3381269
AA seq 536 aa
MPRRPTALLLASLLAGAVQAAPSSLVVCTEGSPEGFDIVQYTAAVSADASAETVFDRLLR
FAPGGTELLPALAERWEVSADGLEYTFQLRQGVRFQRTPWFTPSREFNADDVIWSFRRQI
DPAHPWHRLSPRGFPYAESMAVGELIRRIERLDDHRVRFVLRHPEAPFLANLAMGFASIY
PAEYADRLLAAGTPERLNSQPVGSGPFVFERYEKDAQVRFRRNPDYWDGAPAIERLIFAI
TPEPNVRVQKLKAGDCQIALYPRPVDLPGLRRDPRIEVLEDEPLLTAYIGINTRHPPLDD
VRVRQALNLAFDKTAYLRTQYGEDGASPAVAPYPPSLWGSDPSLEGWPHDPARARALLAE
AGHASGLKLAIWTRPGGGPTNPNPGIGAQLLQADLATIGIQAEIRVLEWGELIKRAKNGE
HDLVFMGWAGDNGDPDNFLTPNLSCAAAASGENQAGWCNEHFDALLREARRATDQAQRAA
LYRQALAIFHEQAPWIPLAHPREFAAVRRDVEGFVISPLGTNNFAGVRRTSASDPE
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgccccgacgcccgaccgccctcctcctcgccagcctgctcgccggcgccgtccaggcc
gcgccgagcagcctggtggtgtgcaccgaaggcagcccggaaggcttcgacatcgtccag
tacaccgccgccgtcagcgccgatgcctcggcggagacggtgttcgaccgcctgctgcgc
ttcgcccccggcggcaccgagctgctccccgccctcgccgagcgctgggaggtgtccgcc
gacggcctcgaatacaccttccagctgcgccagggtgtgcgcttccagcgcacgccctgg
ttcaccccgagccgggaattcaacgccgacgacgtgatctggagcttccggcgccagatc
gaccccgcgcacccctggcacaggctgtcgccgcgcggcttcccctatgccgagtcgatg
gccgtcggcgagcttatccggcgcatcgagcggctcgacgaccatcgcgtgcgcttcgtc
ctgcgccacccggaggcgcccttcctggccaacctggcgatgggcttcgcctccatctat
ccggccgaatacgccgaccggctgctcgcggccggcaccccggagcgcctcaacagccag
ccggtgggcagcggccccttcgtcttcgagcgctacgagaaggacgcccaggtgcgcttt
cggcgcaacccggactactgggacggcgcgccggccatcgaacggctaatcttcgccatc
acccccgagcccaacgtgcgggtgcagaagctcaaggccggcgactgccagatcgccctc
tacccgcgcccggtggacctgcccggactgcgcagggacccacgcatcgaagtgctggag
gacgagccgctcttgaccgcctacatcggcatcaacacccgccacccgccgctcgacgac
gtgcgggtgcgccaggccctcaaccttgccttcgacaagaccgcctacctgcgcacccag
tacggcgaggacggcgccagcccggcggtggcgccctacccgccgagcctgtggggctcg
gacccgagcctcgaaggctggccccacgatccggcgcgggcgcgggcgctgctggccgaa
gccggccatgccagcggtctgaagctggccatctggacccgccccggcggcgggccgacc
aatcccaaccccggcatcggcgcccagctgctgcaggccgacctggccaccatcggcatc
caggcggaaatccgcgtgctggaatggggcgagctgatcaagcgggcgaagaacggcgag
cacgacctggtgttcatgggctgggccggcgacaacggcgacccggacaacttcctcacc
cccaacctgtcctgcgccgccgccgcctcgggagagaaccaggccggctggtgcaacgag
cacttcgacgccctgctccgtgaagcccgccgcgccaccgaccaggcgcagcgcgccgcg
ctctaccgccaggccctggcgatcttccacgaacaggcaccctggattcccctggcccat
ccccgcgagttcgccgccgtacgccgcgatgtcgagggcttcgtgatcagcccgctgggc
accaacaacttcgccggagtgcgccgcacttcggccagcgatccggagtga

KEGG   Azotobacter chroococcum: Achr_37430
Entry
Achr_37430        CDS       T03640                                 
Name
(GenBank) extracellular solute-binding protein
  KO
K12368  dipeptide transport system substrate-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_37430
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Achr_37430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_37430
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Dipeptide transporter
    Achr_37430
SSDB
Motif
Pfam: SBP_bac_5 DUF6381
Other DBs
NCBI-ProteinID: AJE23133
UniProt: A0A0C4WK89
LinkDB
Position
4158797..4160374
AA seq 525 aa
MRLALLPLLFAPLLSQAASLVVCTEASPEGFDVVRYNSLTTTNASADVLMDRLVEFDPES
GQLQPGLAQSWQVSADGLVYDFRLREGVAFHRTPWFTPSRTLTAEDVLFSFRRMLDPTHP
WHRTAPSGYPHAQSMQLGELIRSIEAVGPQQVRFTLARPDATFLATLSMGFASIYSAEYA
ARLLAAGTPEQLDSQPVGTGPFVLKRYQKDALVRYLANPDYFAGKPAVDGLVLAITPDAN
VRLQRLRRGECQIALSPKPQDVRAAQDDPSLEVVATPAFMTAFVALNSQHPPLDRPEVRQ
AINLAFDKASYLKAVFEGSAQPADGPYPPTTWSHAADLPGYPHDPARARELLARAGLAEG
FKTTIWTRPAGSLLNPNPALGAQLLQADLAKVGILAEIRVIEWGELIRRAKAGEHDLLFM
GWAGDNGDPDNFLTPQFACASVASGLNFARYCDARLDQLIAAGRRSSDQAERSRLYREAQ
KLIREQALWLPLAHPTAAVLVRKAVEGYQANPFGRQDFSKVQLGR
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgcgcctcgcccttcttccgctgttgttcgccccgctgctgagccaggccgccagtctc
gtcgtctgcaccgaggccagcccggaggggttcgacgtggtgcgctacaactcgctgacc
accaccaacgcctccgccgacgtgctgatggaccgtctggtcgagttcgacccggaaagc
ggccagctgcagccgggcctggcgcagagctggcaggtgtccgcggacggtctggtctac
gacttccggctgcgcgaaggcgtggccttccaccgtacgccctggttcaccccgagccgg
acgctgactgccgaggacgtgctgttcagcttccggcgcatgctcgatccgacccacccc
tggcacaggacggcgccgagcggctatccgcacgcccagtcgatgcagctcggcgagctg
atccgcagcatcgaggcggtcgggccgcagcaggtgcgctttaccctcgcccgccccgac
gccaccttcctcgccaccctgagcatgggcttcgcctccatctattcggccgagtacgcc
gcccggctgctggccgccggcacgccggagcagctcgacagccagccggtcggcaccggc
cccttcgtgctcaagcgctaccagaaggacgcgctggtgcgctatctggccaaccccgac
tacttcgccggaaagcccgccgtcgacgggctggtcctggccatcaccccggacgccaac
gtgcgcctgcagcgcctgcgccgcggcgagtgccagatcgccctgtcgccgaagccgcag
gacgtgcgcgcggcgcaggacgatccgagcctcgaggtggtcgccaccccggccttcatg
accgccttcgtcgccctcaacagccagcacccgccgctggacaggcccgaggtgcgccag
gcgatcaacctcgccttcgacaaggccagctacctgaaggcggtgttcgagggcagcgcg
cagccggccgacggcccctatccgccgactacctggagccatgccgccgacctgccgggc
tatccccacgatccggcccgggcccgcgaactgctggccagggcagggctggcggaaggc
ttcaaaaccactatctggacgcgtccggccggcagcctgctcaaccccaacccggcgctc
ggcgcccagctgctgcaggccgacctggccaaggtcggcatcctggcagagatccgggtg
atcgagtggggcgagctgatccgccgcgccaaggccggcgagcacgacctgctgttcatg
ggctgggccggcgacaacggcgaccccgacaacttcctcaccccgcagttcgcctgcgcc
tcggtcgcgtcgggactgaacttcgcgcgctactgcgacgcccggctggaccagctgatc
gccgcgggcaggcgcagcagcgaccaggccgagcgcagccggctgtaccgggaggcacag
aagctgatccgcgagcaggcgctgtggctgccgctggcccaccccaccgccgccgtgctg
gtccgcaaggccgtcgagggctatcaggccaacccgttcgggcgccaggatttcagcaag
gtgcagctgggccgctga

DBGET integrated database retrieval system