KEGG   Azotobacter chroococcum: Achr_30750
Entry
Achr_30750        CDS       T03640                                 
Symbol
valS
Name
(GenBank) valyl-tRNA synthetase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_30750 (valS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acx01007]
    Achr_30750 (valS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acx03016]
    Achr_30750 (valS)
Enzymes [BR:acx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     Achr_30750 (valS)
Amino acid related enzymes [BR:acx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Achr_30750 (valS)
Transfer RNA biogenesis [BR:acx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Achr_30750 (valS)
 Prokaryotic type
    Achr_30750 (valS)
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 Val_tRNA-synt_C tRNA-synt_1g tRNA-synt_1_2 ABC_tran_CTD tRNA-synt_1e tRNA-synt_1f
Other DBs
NCBI-ProteinID: AJE22484
UniProt: A0A0C4WPE4
LinkDB
Position
3441666..3444500
AA seq 944 aa
MDKTYQPHAIESRWYAEWESKNYFAPQGSGEPYTIMIPPPNVTGSLHMGHGFNNAIMDAL
IRFRRMQGRNTLWQPGTDHAGIATQMVVERQLAAQGVSRHDLGREKFLDKVWEWKEESGG
TITRQIRRLGSSVDWSRERFTMDEGLSEAVKEAFVRLFDDGLIYRGKRLVNWDTKLHTAI
SDLEVENHDEKGHLWHLRYPLADDARTAEGKAYLVVATTRPETMLGDAAVAVHPEDERYK
DLIGRHVLLPLVNRLIPIVADEYVDREFGTGCVKITPAHDFNDYEVGKRHHLPLINIFDK
NASVLAQAQVFDIDGTPNTRIDPSLPDSYASMDRFDARKAIVADFDGMGLLEKIDDHALK
VPRGDRSGTIIEPWLTDQWYVSTKPLAEKAIAAVEDGSIQFVPKQYENMYFSWMRDIQDW
CISRQLWWGHRIPAWYDEAGNAYVGRDEAEVRSKYAIRNDEPLRQDEDVLDTWFSSGLWT
FSTLGWPQQTEFLKTFHPTDVLVTGFDIIFFWVARMIMMSLHLTGQIPFKTVYVHGLVRD
AQGQKMSKSKGNVLDPLDIVDGIDLDTLLTKRTSGMMQPKLAEKIAKQTRAEFPEGIASY
GTDALRFTFCSLASTGRDIKFDMGRVEGYRNFCNKLWNAANFVFENTEGKDCGAAGEPVE
LSPVDRWIVSQLQRTELEVTRQLDAFRFDLAAQALYEFVWDQYCAWYLELVKPVLWDETA
PTSRQRGTRRTLVRVLETALRLAHPFMPFITEEIWQRLAPLAGKSGPTLMLQPWPVADEA
RIDEAAEDDIEWVKALMLGIRQIRGEMNISMARRIDVALNNASASDRRRLAENEPLLAKL
AKLESIRILEAGEEAPLAATALVGEMQVLVPMAGLIDKDAELARLDKEIQRLEGEVKRVG
GKLGNASFVDKAPAEVIAKERAKLTEAEQALARLGEQRARIANL
NT seq 2835 nt   +upstreamnt  +downstreamnt
atggacaagacctaccagccgcacgccattgaatcccgttggtacgccgaatgggagtcg
aagaactacttcgccccgcagggcagcggcgagccctacaccatcatgatcccgccgccg
aacgtcaccggcagcctgcacatgggccacggcttcaacaacgcgatcatggacgcgctg
atccgcttccgccgcatgcagggccgcaacacactgtggcagccgggcaccgaccatgcc
ggcatcgccacccagatggtggtggagcgccagctggccgcccagggcgtcagccgccac
gacctcggccgcgagaagttcctcgacaaggtctgggagtggaaggaggagtccggcggc
accatcacccggcagatccgccgcctgggcagttcggtggactggtcgcgggagcgattc
accatggacgagggcctctccgaagcggtcaaggaagccttcgtgcgcctctttgatgac
ggcctgatctaccgcggcaagcgcctggtcaactgggacaccaagctgcacaccgcgatc
tccgacctcgaagtggaaaaccacgacgagaagggccacctctggcacctgcgctacccg
ctggccgacgacgcccgcaccgccgagggcaaagcctacctggtggtcgccaccacccgt
ccggaaaccatgctgggcgatgccgccgtcgccgtgcatccggaggacgagcgctacaag
gacctgatcggccgccacgtgctgctgccgctggtcaaccgcctgatcccgatcgtcgcc
gacgagtacgtcgaccgcgagttcggcaccggctgcgtgaagatcaccccggcccacgac
ttcaacgactacgaggtcggcaagcgccaccacctgccgctgatcaacatcttcgacaag
aacgccagcgtcctggcccaggcccaggtgttcgacatcgacggcacgccgaacacgcgc
atcgaccccagcctgccggacagctacgccagcatggaccgcttcgacgcgcgcaaggcc
atcgtcgccgacttcgacggcatgggccttctggagaagatcgacgaccacgcgctgaag
gtgccgcgcggcgaccgctcgggcaccatcatcgaaccctggctgaccgaccagtggtac
gtctccaccaagccgctggccgagaaggccatcgccgccgtcgaggacggttccattcag
ttcgtgcccaagcagtacgagaacatgtatttctcctggatgcgcgacatccaggactgg
tgcatcagccgccagctctggtggggccaccgcatcccggcctggtacgacgaggccggc
aacgcctacgtcggccgcgacgaggcggaagtgcgcagcaagtacgcgatccgcaacgac
gagccgctgcgtcaggacgaggacgtgctggacacctggttcagctccggcctgtggacc
ttctccaccctcggctggccgcagcagaccgagttcctcaagaccttccaccccaccgac
gtgctggtcaccggcttcgacatcatcttcttctgggtcgcccggatgatcatgatgtcc
ctgcacctgaccgggcagatccccttcaagaccgtctacgtccacggcctggtgcgtgac
gcccagggccagaagatgtccaagtccaagggcaacgtactcgacccgctggacatcgtc
gacggcatcgatctcgacaccctgctgaccaagcgcaccagcggcatgatgcagcccaag
ctggcagagaagatcgccaagcagacccgcgccgaattccccgagggcatcgccagctac
ggcaccgacgcgctgcgcttcaccttctgctcgctggcctccaccgggcgcgacatcaag
ttcgacatgggccgcgtcgagggttaccgcaacttctgcaacaagctgtggaacgccgcc
aacttcgtcttcgagaacaccgagggcaaggactgcggcgccgccggcgagccggtcgag
ctgtccccggtggaccgctggatcgtttcccagctgcagcgcaccgaactcgaggtgacc
cgccagctcgacgccttccgcttcgacctcgccgcccaggcgctctacgaattcgtctgg
gaccagtactgcgcctggtacctggagctggtcaagccggtgctctgggacgagaccgcc
ccgacctcccgccagcgcggcacccgccgcaccctggtgcgggtgctggaaaccgcgctg
cgcctggcgcaccccttcatgcccttcatcaccgaggaaatctggcagcgcctggcgccg
ctggccggcaagtccggcccgaccctgatgctgcagccctggccggtggccgacgaggcg
cgcatcgacgaagccgccgaggacgacatcgagtgggtcaaggcgctgatgctcggcata
cggcagatccgcggcgagatgaacatctccatggccaggcgcatcgacgtggcgctcaac
aacgcctcggccagcgaccgccgccgcctcgccgagaacgaaccgctgctggccaagctg
gccaagctggaatcgatccgcattctggaagccggcgaggaagcgccgctggccgccacc
gcgctggtcggcgagatgcaggtgctggtgccgatggccgggctgatcgacaaggacgcc
gaactggcccgcctggacaaggaaatccagcgcctggagggcgaggtcaagcgcgtcggc
ggcaagctgggcaacgccagcttcgtcgacaaggcccccgccgaggtgatcgccaaggag
cgcgccaagctgaccgaagccgaacaggccctggccaggctgggcgagcagcgcgcgcgc
atcgccaacctctga

DBGET integrated database retrieval system