KEGG   Azotobacter chroococcum: Achr_33660
Entry
Achr_33660        CDS       T03640                                 
Symbol
hfq
Name
(GenBank) RNA-binding protein Hfq
  KO
K03666  host factor-I protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Achr_33660 (hfq)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_33660 (hfq)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:acx03019]
    Achr_33660 (hfq)
   03036 Chromosome and associated proteins [BR:acx03036]
    Achr_33660 (hfq)
Messenger RNA biogenesis [BR:acx03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     Achr_33660 (hfq)
Chromosome and associated proteins [BR:acx03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucleoid associated proteins
    Achr_33660 (hfq)
SSDB
Motif
Pfam: Hfq LSM
Other DBs
NCBI-ProteinID: AJE22771
UniProt: A0A0C4WQ18
LinkDB
Position
complement(3767988..3768242)
AA seq 84 aa
MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS
TVVPSRPVRLPTASEGEQPEPGNA
NT seq 255 nt   +upstreamnt  +downstreamnt
atgtcaaaagggcattcgctacaagacccttaccttaatacgctgcgcaaagagcgcgtt
ccggtttccatctatctggtcaacggcatcaagctgcagggccagatcgagtccttcgac
cagttcgtgattctgctgaagaacactgtcagccagatggtctacaagcacgcgatttcc
accgtggtgccgagccgtccggtgcgcctgcccactgcgagcgagggcgagcagcccgaa
cccggcaacgcctga

DBGET integrated database retrieval system