KEGG   Azotobacter chroococcum: Achr_34450
Entry
Achr_34450        CDS       T03640                                 
Symbol
ribA
Name
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
acx  Azotobacter chroococcum
Pathway
acx00740  Riboflavin metabolism
acx00790  Folate biosynthesis
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
acx01240  Biosynthesis of cofactors
acx02024  Quorum sensing
Module
acx_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Achr_34450 (ribA)
   00790 Folate biosynthesis
    Achr_34450 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_34450 (ribA)
Enzymes [BR:acx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Achr_34450 (ribA)
SSDB
Motif
Pfam: GTP_cyclohydro2
Other DBs
NCBI-ProteinID: AJE22850
UniProt: A0A0C4WTA6
LinkDB
Position
complement(3851824..3852450)
AA seq 208 aa
MSVVFVAASKLPTPFGVFTMHGFLDEATGKEHVALTLGKVDDGAPVLGRLHSECLTGDAL
FSLRCDCGFQLEAALCAIAAEGRGVLLYLRQEGRGIGLLNKIRAYKLQDAGADTVEANER
LGFRADQRDYGICKPMLEYLGIAAIKLMTNNPRKVKALEGSGIRVAERVPLQTGLNPHNQ
KYLATKAGKLGHLLGSLHQGEVETPAES
NT seq 627 nt   +upstreamnt  +downstreamnt
gtgtccgtcgtcttcgtcgccgcatccaagctgcccacgccgttcggcgtcttcaccatg
catggctttctcgacgaagccaccggcaaggagcatgtggcgctcaccctgggcaaggtg
gacgacggcgcgccggtgctcggccgcctgcattccgagtgcctgaccggcgacgcgctg
ttcagcctgcgctgcgactgcggcttccagctggaggcggcgctgtgcgccatcgccgcc
gaaggccgcggcgtgctgctctacctgcgccaggaagggcgcggcatcggcctgctgaac
aagatccgcgcctacaagctgcaggatgccggggccgacaccgtcgaggccaacgagcgc
ctgggctttcgcgccgaccagcgcgactacgggatctgcaagccgatgctcgagtatctg
ggcatcgccgcgatcaagctgatgaccaacaacccgcgcaaggtcaaggcgctggaaggc
tccggcatccgggtggccgagcgggtgccgctgcagaccggactcaatccgcacaaccag
aaatacctggccaccaaggccggcaagctcggccatctgctcggcagcctgcatcagggc
gaggtggagacgccggccgagagctga

DBGET integrated database retrieval system