KEGG   Azotobacter chroococcum: Achr_34550
Entry
Achr_34550        CDS       T03640                                 
Symbol
ribD
Name
(GenBank) Riboflavin biosynthesis protein RibD
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
acx  Azotobacter chroococcum
Pathway
acx00740  Riboflavin metabolism
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
acx01240  Biosynthesis of cofactors
acx02024  Quorum sensing
Module
acx_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Achr_34550 (ribD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_34550 (ribD)
Enzymes [BR:acx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     Achr_34550 (ribD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     Achr_34550 (ribD)
SSDB
Motif
Pfam: RibD_C dCMP_cyt_deam_1 MafB19-deam APOBEC_N
Other DBs
NCBI-ProteinID: AJE22859
UniProt: A0A0C4WQC3
LinkDB
Position
complement(3858636..3859727)
AA seq 363 aa
MARALELARRGLYSTHPNPRVGCVIVADGAVVGEGWHVRAGEPHAEVHALRQAGEAARGA
TAYVTLEPCSHHGRTPPCAEALVAAGVGRVVAAMQDPNPQVSGRGLARLRQAGIEVEVGV
LEAEARALNAGFVKRMERGLPLLRVKLAMSLDGRTAMASGESQWITGAPARAAVQRLRAR
SSVVLTGADTVLADHARLTVRGAELGLAPEQAALALQRPPLRVLVDGRLRVPLDAPFFQA
QAGPALVATLAAEREAAYRAAGHELLAVPGEEGRVDLPALLAELAARGANEVLVEAGPRL
AGAFARLGLVDEYRIFVAPKFLGSSARPLLELPLERMAEARELKIRDIRAVGDDWQIIAV
PAL
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcccgcgccctggaactggcgcgccgggggctgtattccacccatcccaatccgcgg
gtcggctgcgtgatcgtcgccgacggcgcggtggtcggcgagggctggcacgtgcgcgcc
ggcgagccgcacgccgaggtccacgccctgcgccaggccggcgaggcggcgcgcggtgcc
accgcctacgtcaccctggagccctgcagccaccatgggcgcacgccgccctgcgccgag
gcgctggtcgccgccggggtcggccgggtggtggcggccatgcaggaccccaatccgcag
gtgtccgggcgcggccttgcgcgtctgcgccaggccggcatcgaggtcgaggtcggcgtg
ctggaggccgaggcgcgcgcgctcaacgccggtttcgtcaagcgcatggagcgtggtctg
ccgctgctgcgggtcaagctggcgatgagtctggacggccgcacggcgatggccagcggt
gagagccagtggatcaccggggcgccggcgcgcgccgcggtgcagcgcctgcgcgcccgt
tccagcgtggtgctgaccggtgccgacacggtgctcgccgaccatgcccggctcaccgtg
cgcggcgcggaactggggctggcgcccgagcaggccgccctggcgctgcagcgcccgccg
ctgcgcgtgctggtcgacgggcgcctgcgggtgccgctggacgcgcccttcttccaggcc
caggccggaccggcgctggtggcgacccttgcagccgagcgcgaggccgcctaccgcgcg
gccggccacgagctgctggccgtgccgggcgaggagggcagggtcgacctgccggcgctg
ctggccgaactggccgcgcgcggcgccaacgaggtgctggtggaggccgggccgcgcctg
gccggggccttcgcccggctggggctggtcgacgagtaccggatcttcgtcgcgcccaag
ttcctcggctcgagcgcccggccgctcctggagctgcccctggagcgcatggccgaggcg
cgcgagctgaagatccgcgacatccgcgcggtgggcgacgactggcagatcatcgccgtg
cccgcgctctag

DBGET integrated database retrieval system