KEGG   Azotobacter chroococcum: Achr_35230
Entry
Achr_35230        CDS       T03640                                 
Symbol
secE
Name
(GenBank) Preprotein translocase subunit SecE
  KO
K03073  preprotein translocase subunit SecE
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_35230 (secE)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_35230 (secE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_35230 (secE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_35230 (secE)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_35230 (secE)
SSDB
Motif
Pfam: SecE DUF3397 DUF4271 VIT1 DUF1616 TPPK_C DUF4191
Other DBs
NCBI-ProteinID: AJE22923
UniProt: A0A0C4WJV5
LinkDB
Position
complement(3912675..3913043)
AA seq 122 aa
MNAKAEAKESRFDLVKWLVVVVLVAVGVVGNQLYSEESILYRVIALLVLGVVAAFVALKT
SKGQAFFSLAKEARAEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSMI
VG
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaatgccaaggctgaagctaaagagtctcgctttgatttggtgaagtggctcgtggtg
gtggtcttggtcgcagtgggtgtagttggtaatcagctatactccgaagagtccatcctg
tatcgcgttatcgcattgctggttctgggggttgtggcggccttcgttgcgctcaagacc
agtaaggggcaggcttttttctctctggcgaaagaagcgcgtgccgaaattcgcaaggtt
gtctggccgacccgtcaagagactacgcagaccacgttgatcgtggtggctgtagttctg
gtgatggcgctactgctgtgggggcttgattccctgcttggttggctggtctccatgatc
gttggttaa

DBGET integrated database retrieval system