KEGG   Azotobacter chroococcum: Achr_35990
Entry
Achr_35990        CDS       T03640                                 
Name
(GenBank) general secretion pathway protein C
  KO
K02452  general secretion pathway protein C
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_35990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_35990
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_35990
SSDB
Motif
Pfam: T2SSC T2SSB
Other DBs
NCBI-ProteinID: AJE22994
UniProt: A0A0C4WQQ4
LinkDB
Position
4009743..4010312
AA seq 189 aa
MILLTVASIQAVGIAKTLFWPESSASAAPLERREATPGDTPTLDLKAIQQAELFGSLAEE
PAQKALATQVKSRLSVKLLGVVKAPQGGTSVAILAEAGRQRAYAVGDRLSGNGDARLIEI
LADRVVFEVSGQQQYVELEKPALNDTKVSIVASAPLQTSRSPRPGGAGTGGEADSSRRAP
GRTDPGYQN
NT seq 570 nt   +upstreamnt  +downstreamnt
atgattctgctgacagttgcctcgatccaggcggtagggatcgccaaaacgctcttttgg
cccgagtcatcggcctccgcggcgccactcgagcgacgcgaggcaacaccgggcgatacg
ccgacgctcgatctcaaggccatccagcaggcggaactgttcggctcgcttgcagaggag
ccggcccaaaaggcgcttgcgacgcaggtgaaaagccgtctgagcgtcaagctgctgggc
gtcgtcaaggccccccaggggggcacttccgtggccatcctcgcagaagccggtcggcag
cgagcctatgccgtcggcgacagactgtcaggcaacggcgacgccaggctgatcgaaatc
ctggcggaccgggtggtgttcgaggtgtccggtcagcagcaatacgtcgagctggaaaag
cccgccctgaatgacacaaaggtctccatcgtcgccagcgcgccgctccagacgagccga
tcgccacggcctggcggagccggcacgggcggcgaagcggattcgagtcgccgtgcgccg
gggcgaacggacccgggctatcaaaattga

DBGET integrated database retrieval system