KEGG   Azotobacter chroococcum: Achr_36050
Entry
Achr_36050        CDS       T03640                                 
Name
(GenBank) general secretion pathway protein H
  KO
K02457  general secretion pathway protein H
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_36050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_36050
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_36050
SSDB
Motif
Pfam: GspH N_methyl
Other DBs
NCBI-ProteinID: AJE23000
UniProt: A0A0C4WTK7
LinkDB
Position
4016455..4016967
AA seq 170 aa
MQPISATSPVRGFTLLEVMLVMAILGMLAVTVSLALPESSQQRLESEARRLKAQIGLAAE
QAIYRNRDHGLWLGEAGYRFYRREKARWLPVDTDSRLAALALNEGTTLRLRMAGQPVDTS
GKAREPQIFIASDGQISEFELTLGHPDAQWPQVIRASFAGNLRLVQAERP
NT seq 513 nt   +upstreamnt  +downstreamnt
ttgcagccgatatcggcaactagccctgtccgcggcttcaccctgctggaagtgatgctg
gtgatggcgattctgggcatgctggcggtcaccgtctccctggcgctgccggagtcgtcc
cagcaacgcctggaaagcgaggcgcgccgcctgaaggcgcagatcggtctggcggcggaa
caggccatctaccgcaatcgcgaccatggcctgtggctgggcgaggccggctatcgcttc
tatcgacgcgagaaggcgcgctggctgccggtggacaccgattcgcggctggcggccctg
gcgctgaacgaggggaccaccctgcgcctacgcatggcgggacaaccggtcgatacgagc
gggaaggcgcgcgagccgcagatcttcatcgccagcgacggccagatcagcgagttcgaa
ttgaccctcggccatcccgacgcgcaatggccgcaggtgatccgcgccagcttcgcgggc
aatctgcgcctggtgcaggcggagcggccgtga

DBGET integrated database retrieval system