KEGG   Azotobacter chroococcum: Achr_36070
Entry
Achr_36070        CDS       T03640                                 
Name
(GenBank) general secretion pathway protein J
  KO
K02459  general secretion pathway protein J
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_36070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_36070
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_36070
SSDB
Motif
Pfam: T2SSJ N_methyl
Other DBs
NCBI-ProteinID: AJE23002
UniProt: A0A0C4WVY1
LinkDB
Position
4017329..4017955
AA seq 208 aa
MKGSGGFTLLEVLVAMALLALLGLAAALTLNSGLRSQQVVGESIESLQRLQLAQQLLRRD
LEQLVVRQGRNERGDVRPQVLVAPANGDPQGVLLDFYKTGRRILSRSSPGSSLERVRYRL
RNGRLIRESSPLIDTPVGTQWHSATLLEAVEGIDLRFFHNRTWIDQWPPLRDAAGQGSAA
MLPQALELTIETDRYGAVAQIVLLPSAP
NT seq 627 nt   +upstreamnt  +downstreamnt
gtgaagggcagcggcggcttcaccctgctcgaagtgctggtggcgatggccctgctggca
ctgctcgggctcgccgcggcgctgacgctcaacagcggcctgcgcagccagcaggtggtg
ggcgaaagcatcgagtcgctgcagcgcctgcagctggcccagcagctgctgcgccgggac
ctggagcaactggtcgtccgccagggacggaacgagcggggcgacgttcgaccccaggtg
ctggtggctcctgccaacggcgatccgcaaggggtgcttctggatttctacaagaccggc
cggcgcatcctgtcccgctcgtcgccggggtccagcctcgagcgcgtgcgctatcgcctg
cgcaacgggcgtctgattcgcgaaagctcacccctgatcgacaccccggtgggcacgcaa
tggcacagcgccacgctgctggaagcggtggagggcatcgacctgcgttttttccacaac
cgcacctggatcgaccaatggccgccgctgcgtgacgcggccggccagggttcggccgcg
atgctcccccaggcgctggagctgaccatcgagaccgatcgctatggagcggtggcgcag
atcgtgctgctgccgagcgccccatga

DBGET integrated database retrieval system