KEGG   Azotobacter chroococcum: Achr_36080
Entry
Achr_36080        CDS       T03640                                 
Symbol
gspK
Name
(GenBank) General secretion pathway protein K
  KO
K02460  general secretion pathway protein K
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_36080 (gspK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_36080 (gspK)
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_36080 (gspK)
SSDB
Motif
Pfam: T2SSK
Other DBs
NCBI-ProteinID: AJE23003
UniProt: A0A0C4WK07
LinkDB
Position
4017952..4019001
AA seq 349 aa
MKGSAMAARRHGRGMALMVVLLVVALISLIATHLGSLVQLNIQQAANREQYQQAYWFALG
GERLARKLLESALKTDKLTHPRQAWADPRLSYPIDGGVIRIRIQDQNACFNLNALTTLNT
PQDASQTKEPLLLRQFVRLLVELGADESQTAQLVEPLRDWLDNDTLPTGLKGAEDLFYTG
LEPAYLPANGPLADPTELHLIDGFRQLAAKARDDEQGFLKRLRPYLCALPGTKLQVNVNS
LGPEQAPLLSALFEGQVPHRLLTQWLSERPAEGFRSVDEFWALLTQSGDDTLSTDVDAAV
KTQLKVSSEFFLARIEVDYHDANLVLQSRIQVRNGTSAVYQRHYGALDE
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaagggctcggcaatggcggccaggcggcatggccgcggcatggcgctgatggtcgta
ttgctggtggtggccctgatctccctcatcgcgacccacctgggatcgctggtccagctc
aacatccagcaggcggccaaccgcgagcagtatcagcaggcctactggttcgccctgggt
ggcgagaggctggcgcgcaaactgctggaatcggccctcaagaccgacaagctcacccac
ccgcggcaggcctgggccgatccgcggctcagctacccgatcgacggcggcgtcatcaga
atccgcatccaggaccagaacgcctgcttcaatctcaatgccctgaccacgctgaacacg
ccccaggacgcctcccagaccaaggaaccgctgctcttgcgccagttcgtccgcctgctg
gtggagctgggggccgacgagtcgcagacggcgcaactggtcgagccactgcgcgactgg
ctcgacaacgacaccctgccgaccggactcaagggtgccgaagacctgttctataccggc
ctggagccagcctatctgccggcgaacggccccttggcggacccgaccgagcttcatctc
atcgacggcttccggcagctggccgccaaggcccgggacgacgaacagggttttctgaag
aggcttcgtccttatctgtgcgccctgcccggcaccaagctgcaggtcaacgtgaatagc
ctcggcccggagcaggcaccgctcctgtcggccctgttcgagggacaggtcccccaccgt
ctgctgacgcaatggttgagcgaacggcccgcggaaggctttcgcagtgtggacgagttc
tgggcgctgctgacccagagcggcgacgacacgctctccaccgacgtcgacgcggccgtc
aagacgcagctcaaggtctcctccgaattctttctggcccggatcgaggtcgactaccac
gacgcgaatctggtgctgcagtcacggatccaggtgcgcaacggcacctccgccgtgtac
caacgccattatggagcgctcgatgaatga

DBGET integrated database retrieval system