KEGG   Azotobacter chroococcum: Achr_37470
Entry
Achr_37470        CDS       T03640                                 
Symbol
ftsY
Name
(GenBank) Signal recognition particle receptor FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_37470 (ftsY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_37470 (ftsY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_37470 (ftsY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_37470 (ftsY)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_37470 (ftsY)
SSDB
Motif
Pfam: SRP54 SRP54_N Zeta_toxin AAA_30 AAA_22 MeaB DUF2075 APS_kinase AAA_17 AAA_33 AAA_16 ABC_tran Thymidylate_kin VirC1 CbiA AAA_31 MMR_HSR1 AAA_19 YqeC AAA DO-GTPase2 DO-GTPase1 Fer4_NifH AAA_24 MobB NTPase_1 cobW Keratin AAA_18 ResIII NACHT Arf ArsA_ATPase ATP_bind_1 AAA_7 AAA_28
Other DBs
NCBI-ProteinID: AJE23137
UniProt: A0A0C4WW63
LinkDB
Position
complement(4163106..4164494)
AA seq 462 aa
MFGSNDDKKPAEAGEKKGLFGWFRKKEQSAPAPAPEEAAPEAGSEEPSPAEEAAEAARPA
EPEPQPAVVEVPAPVVEVQPETPAVGSSVPEVADQAPAAPEEEVVFSSRWRGAAHGTPAP
AAEAAPVSEPEPLPAVEAEPAVPVAQPAPRPNKSGFFARLRQGLAKTGSTLGEGMASLFL
GEKAIDDELLEELETRLLLADVGVEATTAIIQSLTLRVARKELADSEALYRALQEELTAL
LKPVEQPLALESAQRPYVILVVGVNGAGKTTTIGKLAARLQQDGKKVMLAAGDTFRAAAV
EQLQVWGERNRIPVIAQHTGADSASVIFDALQAAKARGMDVLIADTAGRLHTKDNLMEEL
KKVRRVLGKLDDAAPHEVLLVLDAGTGQNAINQTRQFNQAVEVTGLALTKLDGTAKGGVI
FALAKQFGLPIRYIGVGEGVDDLRTFVAEEFVRALFAEKPAQ
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtttggttcaaacgacgacaagaagccggccgaggccggagagaagaaaggcctgttc
ggctggttccgcaagaaggaacaatccgcaccggcgcccgcccccgaggaagctgctccg
gaagccggcagcgaagaaccgtcgccggcggaggaagccgccgaggccgcccgcccggcc
gagcccgagccgcagccggcggtggtcgaggtgccggcgccggtggtcgaggtgcagccg
gagaccccggctgtcggatcgtccgtgcccgaggtcgccgaccaggcgcctgccgcaccc
gaagaggaagtggtcttctccagccgctggcgcggcgccgcgcacggcacgccggctccc
gccgcggaagcggcgccggtgagcgagcccgagccgctgccggcggtcgaggccgagccg
gccgtcccggtcgcccagcccgccccgcggccgaacaagtccggcttcttcgcccgcctg
cgccaggggctggcgaagaccggctcgactctcggcgaaggcatggccagcctgtttctc
ggcgagaaggcgatcgacgacgagctcctggaggagctggaaacccgcctgctgctcgcc
gacgtcggtgtcgaggccaccacggcgatcatccagagcctgaccctgcgggtggcgcgc
aaggagctggccgacagcgaggcgctgtaccgcgcgctgcaggaggagctgaccgcgctg
ctcaagccggtcgagcagccgctggcgctcgagtccgcgcagcgcccctatgtgatcctg
gtggtcggcgtcaacggcgccggcaagaccaccaccatcggcaagctggccgcgcgcctg
cagcaggatggcaagaaggtcatgctcgccgccggcgacaccttccgcgccgccgccgtc
gagcagctgcaggtgtggggcgagcgcaaccggattccggtgatcgcccagcacaccggc
gcggattccgcctcggtgatcttcgatgccctgcaggccgccaaggcgcgcggcatggac
gtgctgatcgccgataccgccggtcgcctgcacaccaaggacaatctcatggaggagctg
aagaaggtccgccgggtgctcggcaagctggacgacgcggcgccccacgaggtgctgctg
gtgctggacgccggcaccggccagaacgccatcaaccagaccaggcagttcaaccaggcg
gtggaggtcaccggcctggcgctgaccaagctggacggcaccgccaagggcggggtgatc
ttcgccctggccaagcagttcggcctgccgatccgctacatcggcgtcggcgagggcgtc
gacgacctgcgcaccttcgtcgccgaggagttcgtccgcgcgctgttcgcggagaagccg
gcgcaatga

DBGET integrated database retrieval system