KEGG   Azotobacter chroococcum: Achr_39900
Entry
Achr_39900        CDS       T03640                                 
Name
(GenBank) Major intrinsic multiple antibiotic resistance efflux outer membrane protein OprM
  KO
K18139  outer membrane protein, multidrug efflux system
Organism
acx  Azotobacter chroococcum
Pathway
acx01501  beta-Lactam resistance
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_39900
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Achr_39900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_39900
   01504 Antimicrobial resistance genes [BR:acx01504]
    Achr_39900
Transporters [BR:acx02000]
 Other transporters
  Pores ion channels [TC:1]
   Achr_39900
Antimicrobial resistance genes [BR:acx01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    Achr_39900
   Multidrug resistance, efflux pump MexJK-OprM [MD:M00642]
    Achr_39900
   Multidrug resistance, efflux pump MexXY-OprM [MD:M00643]
    Achr_39900
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: AJE23376
UniProt: A0A0C4WRN0
LinkDB
Position
4465247..4466758
AA seq 503 aa
MKRKYLTLAVACALALPGCTMIPDYLRPEAPVDAAWPQDAAYAPEQPATRPAADFGWEEF
FRDPALRQMVALAVDNNRNLRQAVLNVEAYRALYRVQRSELFPQIDVEGTQSRQRWPADY
GSGGGGGASGGSSEGGQTSTAPKPEAFIQTHHSVTLGTSAWEADLFGRIRSLTRQTKEDY
LATEEDRRNVHIALVGDVATAYFAWRTDQAQLKLTESTLASYEESLKLIEASEEVGVASQ
LDVRQAKTLVDQARAQKALYTRQIAEDVNALRLLIGGPFPTDLPAGLDINDAMLAGFPAG
LPSDLLLRRPDIRAAEHRLLAANASIGAARAAFFPNISLTARAGTASRDLSGLFDSGSGT
WNAVPTINIPIFTFGRLKGNLEYTKLQKEINVAAYEYSIQTAFREVADGLAARGTYDDQL
KAQGDLVDNNQAYYELARQRYDEGVDSYLTVLDAQRELFAAQQQRLNDRLLQLNGEVGLY
KALGGGWERGSIADATTTAAVTP
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgaagcgcaaatacctgaccctggcggtggcctgcgccctggcactgccgggctgcaca
atgattcccgactacctgcgcccggaagcgccggtcgacgccgcctggccgcaggacgcc
gcctatgcgccggagcagccggccacccggccggccgcggacttcggctgggaggagttc
ttccgcgacccggcgctcaggcagatggtcgcgctggccgtggacaacaaccgcaacctg
cgccaggcggtgctcaacgtggaagcctaccgggcgctgtaccgcgtgcagcgctccgag
ctgttcccgcagatcgacgtggaaggcacccagagccgtcagcgctggcccgccgactac
ggcagcggcggcggcggcggggccagcggcggcagcagcgagggcggccagacgagcacg
gctcccaagcccgaggccttcatccagacccaccactccgtgacgctgggcaccagcgcc
tgggaggcggacctgttcgggcgcatccgcagcctcacccgccagaccaaggaggactac
ctggccaccgaggaagaccggcgcaacgtgcacatcgccctggtcggcgacgtggccacc
gcctacttcgcctggcgcaccgaccaggcccagctcaagctgaccgagtcgaccctggcc
agctacgaggagagcctgaaactgatcgaggccagcgaggaagtgggcgtcgcctcgcag
ctcgacgtgcgccaggcgaagaccctggtcgaccaggcccgcgcgcagaaggccctctac
acccggcagatcgccgaggacgtcaacgccctgcggctgctgatcggcggtcccttcccg
accgacctgccggccggcctcgacatcaacgacgccatgctcgccggcttccccgccgga
ctgccctccgacctgctgctgcgccggccggacatccgcgccgccgagcaccgcctgctg
gccgccaacgccagcatcggcgcggcgcgcgcggcgttcttcccgaacatcagcctgacc
gcccgggcgggcaccgccagccgcgatctgtccggcctgttcgactccggctcgggcacc
tggaacgccgtgccgacgatcaacattccgatcttcaccttcgggcggctcaaggggaac
ctggagtacaccaagctgcagaaggaaatcaacgtcgccgcctacgagtacagcatccag
actgccttccgcgaggttgccgacggcctggccgcgcgtggcacctacgacgaccagctc
aaggcccagggcgacctggtcgacaacaaccaggcctactacgagctggcccgccagcgc
tacgacgagggcgtcgacagctacctgacggtgctcgacgcccagcgcgaactcttcgcc
gcccagcagcagcggctcaacgaccgtctgctgcagctgaacggcgaagtcggcctgtac
aaggcgctcggcggcggctgggaacgcggcagcatcgccgatgcgacgacgacggccgcc
gtcacaccctga

DBGET integrated database retrieval system