KEGG   Azotobacter chroococcum: Achr_40480
Entry
Achr_40480        CDS       T03640                                 
Name
(GenBank) Bacterial extracellular solute-binding protein, family 5
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_40480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_40480
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Achr_40480
SSDB
Motif
Pfam: SBP_bac_5
Other DBs
NCBI-ProteinID: AJE23433
UniProt: A0A0C4WKS3
LinkDB
Position
4552064..4553587
AA seq 507 aa
MKPVWSLLLLLCLSACSPNQDPEVLTLGGPFEFTSQDPARDGFLYTRLQVAESLLEVDDG
GRLLPGLAHDWEVSEDGLIWRFRLRENVRFHDGRPLDADAVVNALEMARRKPGVLRTAPI
AEIRAEDPLAVAVRLARPYNPLGALLAHYSTVILSPASYRDDANVGWMHGTGPYRLEAFD
PPHRIRVARFDDYWGMPALIPKAVYLTGHRAESRALQVMAGQTDIVYTLDPASLDLLRRQ
KDVRVHSERIPRTIQIKLNAGHPFLAERDARLAMSLALDRQGIASRIVRVPGAEANQLIP
PALAGWHLEELPPIRRDLERARQLLAGLGWQPGPDGILQRAGRRFQLTLATYADRPELSV
VATAFQAQLREIGIAVAVNIVNSSGIPATHHDGSLELALVARNYGNVADPLSLLFADYGD
GGNGDWGAMGWRNDELPALLQRLESERDPARYRTHARRISHILAEELPVIPVLFYTQQTA
VSTRVQGFGFDPYERNYRISQMSLAAP
NT seq 1524 nt   +upstreamnt  +downstreamnt
ttgaaacctgtatggtcgttgttgctgctgttgtgcctgagcgcctgcagcccgaaccag
gaccccgaggtgttgaccctcggcggccccttcgaattcaccagccaggacccggcgcgc
gacggtttcctgtatacccgcctgcaggtggccgagagccttctcgaggtggacgacggc
ggccggctgctcccaggcctcgcccacgactgggaggtcagcgaggacggcctgatctgg
cgctttcgcctgcgggaaaacgtgcgcttccatgacggccggccgctggacgccgatgcc
gtcgtcaacgcgctggaaatggcccggcgcaagcccggcgtgctccgcacggcgccgatc
gccgagatccgcgccgaagacccgctggccgtggccgtccggctcgccaggccgtacaac
ccgctgggcgcgctgctggcgcactattcgacggtgatcctctcccccgcctcctaccgg
gacgacgccaatgtcggctggatgcacggcacggggccctaccggctggaagccttcgat
ccgccgcaccgtatccgggtggcccgcttcgacgactactggggcatgccggcgctcatc
ccgaaggcggtctatctcaccgggcaccgcgccgagagccgcgccctgcaggtcatggcc
ggacagaccgacatcgtctacacccttgaccccgccagcctggacctgctgcgccggcag
aaggacgtccgcgtccattccgagcgcatcccccgcacgatccagatcaagctcaacgcg
ggccatccgttcctggccgaacgcgacgcccggctggccatgagcctggccctggaccgc
cagggcatcgccagccgcatcgtccgcgtgcccggcgcggaggccaaccagctgataccg
cccgcgctggccggctggcacctcgaggagctgccgccgatccggcgggacctcgaacgc
gcccggcagttgctcgccggcctgggctggcagccgggaccggatggcatcctgcagcgc
gccggccggcgcttccagctgaccctggccacctacgccgaccgccccgagctgtcggtg
gtcgccacggccttccaggcgcagctgcgggaaatcggcatcgccgtcgccgtgaacatc
gtcaactccagcggcatccccgccacccaccacgacggctcgctggagctggccctggtg
gcgcgcaactacggcaacgtcgccgatcctctgagcctgctgttcgccgactacggcgac
ggcggcaatggcgactggggggcgatgggctggcgcaacgacgagctgccggccctgctg
caacgcctcgagtcggaacgcgacccggcgcgctaccggacgcacgcccggcggatctcg
cacatcctggccgaagagctgccggtgattccggtgctcttctacacccagcagacggcc
gtctcgacccgcgtgcagggtttcggcttcgatccctacgagcgcaactaccgtatttcc
cagatgagcctcgcagccccatga

KEGG   Azotobacter chroococcum: Achr_40490
Entry
Achr_40490        CDS       T03640                                 
Name
(GenBank) Binding-protein-dependent transport systems inner membrane component
  KO
K02033  peptide/nickel transport system permease protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_40490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_40490
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Achr_40490
SSDB
Motif
Pfam: BPD_transp_1 BPD_transp_1_N PrgI
Other DBs
NCBI-ProteinID: AJE23434
UniProt: A0A0C4WS04
LinkDB
Position
4553584..4554522
AA seq 312 aa
MINLFLKRLGQAAFVCWSVGTLGFVLMRLLPGDMAFRVAAGRYGYDNVNLAAAEAVRAEL
GLDQPAWRLYLEWLFDLLRFNLGDSLVSGLPVLGEIAHLLQHTLLLAGVGILIAILIAVP
VGLFAAFRADGWFDRLALTASAFLRAQPVFVIGLVLILIFALELRLFPVAGFDGANHVVL
PAIALALSMAAVSNRVVRHSASTVIRSAFFAFARIKGLSFAQSFARHGLRNCALPVVAFL
GIQLASAIEGIVMIESLFSWPGLGHGLAHAVFNRDVPMIQGAAMALGLIFVGLNLAVDLA
CHLIDPRGRTSA
NT seq 939 nt   +upstreamnt  +downstreamnt
atgatcaatctgttcctgaagcggctgggacaggccgccttcgtgtgctggagcgtcggc
accctcggtttcgtgctgatgcgcctgctgcccggcgacatggcattccgcgtcgccgcg
ggccgctacggctacgacaacgtcaacctggccgccgccgaagccgtgcgcgccgagctg
gggctcgaccagccggcctggcgcctgtacctggagtggctgttcgacctgctgcgcttc
aacctgggcgactcgctggtcagcggcctgccggtgctcggcgagatcgcccacctgctg
cagcacaccctgctgctggccggggtcggcatcctgatcgccatcctgatcgccgtgccg
gtcggcctgttcgccgccttcagggccgacggctggttcgaccggcttgcgctgacggcg
tcggccttcctgcgcgcgcaaccggtgttcgtcatcggcctggtgctgatcctgatcttc
gccctggagctgcgcctgtttccggtcgccggcttcgacggcgcgaaccacgtggtgctg
ccggccatcgcgctggcgctgtccatggccgcggtgtccaaccgcgtggtgcgccacagc
gccagcacggtgatccgctccgccttcttcgccttcgcccgcatcaagggcctgagcttc
gcccagtccttcgcccggcacggcctgcgcaactgcgccctgcccgtggtggcgttcctg
ggcatccagctggccagcgcgatcgagggcatcgtcatgatcgagtccctgttctcctgg
ccgggcctcggccatggcctggcccatgcggtcttcaaccgggacgtccccatgatccag
ggcgcggccatggccctcgggctgatattcgtcggcctgaacctggcggtcgacctggcc
tgccacctgatcgacccgcgcgggagaaccagcgcatga

KEGG   Azotobacter chroococcum: Achr_40500
Entry
Achr_40500        CDS       T03640                                 
Name
(GenBank) Binding-protein-dependent transport systems inner membrane component
  KO
K02034  peptide/nickel transport system permease protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_40500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_40500
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Achr_40500
SSDB
Motif
Pfam: BPD_transp_1 DUF3043
Other DBs
NCBI-ProteinID: AJE23435
UniProt: A0A0C4WUB3
LinkDB
Position
4554519..4555307
AA seq 262 aa
MTLSLRPGQRVGAAVLASLAGFAVLEWLLNSTDPAVQDLANAFAPPSLREPLGTDQFGRS
MLARMGSALRLSLLLSLLCVATSASLGVALGVVAGWRQGLADKLLSFLLNMLLALPGLVL
ILLFAGLAPGSLPMLYVAISLVLWVEYFRVVRAITRSVVASSPMQASRMLGFGWFYRFRR
HLWPAIVAPVLTLAAFGAAGAILALAALGFVSVGLKPPTAELGLMMVELFPYYSDAPWVL
AQPLVAVFLLVFGLHLLAGKNQ
NT seq 789 nt   +upstreamnt  +downstreamnt
atgaccctttccctcaggcccggccagcgggtcggcgccgccgtcctggccagcctcgcc
ggcttcgccgtgctggagtggctgctgaattcgaccgacccggccgtgcaggacctcgcc
aacgccttcgctccgcccagcctccgggaaccgctgggcaccgaccagttcggccgcagc
atgctggcgcggatgggctcggccctgcgcctgtcgctgctgctgagcctgttgtgcgtg
gcgacctcggccagcctgggcgtcgccctgggcgtcgtcgccggctggcggcaggggctg
gccgacaagctgctttccttcctcctgaacatgctgctggcgctgccgggcctggtcttg
atcctgctgttcgccggcctcgcgccgggttcgctgccaatgctctacgtggccatctcg
ctggtgctgtgggtggagtacttccgggtggtgcgcgcgatcacccgcagcgtggtcgcc
tcgtcgcccatgcaggcctcgcggatgctgggcttcggctggttctaccggttccgccgc
cacctctggccggccatcgtcgccccggtgctgaccctggcggcctttggcgccgccggc
gcgattctcgccctggcggcgctcggcttcgtctccgtgggcctgaagccgcccaccgcc
gaactgggcctgatgatggtggagctcttcccctactacagcgacgccccctgggtgctg
gcccagccgctcgtggccgtgttcctgttggtgttcggcctgcacctgctggcggggaaa
aaccaatga

KEGG   Azotobacter chroococcum: Achr_40510
Entry
Achr_40510        CDS       T03640                                 
Name
(GenBank) ATP binding protein of ABC transporter
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_40510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_40510
Transporters [BR:acx02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Achr_40510
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_16 SMC_N Mg_chelatase RsgA_GTPase MMR_HSR1 oligo_HPY AAA_22 AAA_23 DUF87
Other DBs
NCBI-ProteinID: AJE23436
UniProt: A0A0C4WRT8
LinkDB
Position
4555304..4556707
AA seq 467 aa
MSVLLQIENLSVFAGDRPLLENLSLTLARGERLTILGETGAGKSLLIQAIMGLLPPPLRA
SGTLRIEGRDIASLSRGELEHLWGRRIAMLPQEPWHALDPLMRSGRQVAEVYGCVLRQDA
EQAAANARRDLAGVGLEQAGDKLPGQLSGGMAQRLAFCAATAGGAAIVLADEPTKGLDAG
RRDHIADLLRRKGDAGCVLTITHDVDVARRIGGRILVMRDGCLVEEGPADEVLNAPAADY
TRQLIDAAPHRWPRTGSRRPRAGGQEPAVLGARGLAKRRGGKQLFRELDLRVERGEIVGL
VGDSGCGKSSLGDILLGLLAPDAGIVTRAPGIARHKYLKLYQDPPSAFAPATPLERLFDD
LIRLHGLDASRLPPLLEQLRLSPALLERSVHEVSGGELQRLAIARALLLDPVFLFADEPV
SRLDPITARDVVQLLTSVATEHRCAVLLVSHDPELVDKVCDRTLRLE
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgagcgtactgctgcagatcgaaaacctctcggtttttgccggggaccggcctctgctg
gaaaacctgtcgctgaccctggccaggggcgagcggctgaccatcctcggcgagaccggc
gccggcaagagcctcctgatccaggccatcatgggcctgctgccaccgccgctgcgcgcc
agcggcaccctccgcatcgagggccgggatatcgcctcgctgtcccggggcgagctggaa
cacttgtggggccgccgtatcgccatgttgccgcaggagccctggcatgccttggacccg
ctgatgcgcagcggccggcaggtcgccgaggtctacggctgcgtgctgcggcaggacgcg
gagcaggccgccgcgaatgcccgccgcgatctggccggcgtcggcctggagcaggccggc
gacaagctgcccggccagctttccggcggcatggcccagcgcctggccttctgcgccgcg
acggccggcggcgcggccatcgtcctggcggacgaaccgaccaagggtctggatgcgggc
cggcgcgaccatatcgccgacctgctgcgccgcaagggcgatgccggctgcgtgctgacc
atcacccacgacgtggacgtggcacgccggatcggcggccggatcctggtcatgcgcgac
ggatgcctggtcgaggaaggaccggccgatgaggtgctgaacgccccggcggccgactac
acccgccaactgatcgacgcggcgccccaccgctggccgcggaccggaagccgccgccct
cgcgccggcgggcaggagccggccgtcctcggggcccgagggctcgccaagcgccgcggt
ggaaagcagctgttccgggagctcgacctgcgcgtggagcggggcgagatcgtcggcctc
gtcggcgacagcggctgcggcaagagcagcctgggcgacatcctgctcggcctgctggcg
ccagacgccggcattgtgacgcgcgcccccggcatcgcccggcacaagtacctgaagctg
taccaggacccgccctccgcgttcgctcccgcgacgcccctggagcgcctgttcgacgac
ctgatccggctgcacgggctcgacgcgtcccggctgccgcccctgctggagcagctgcgg
ttgagcccggccctgctcgaacggtccgtgcacgaggtgtcgggcggcgaactgcagcgc
ctggccatcgccagggcgctgctgctggacccggtcttcctgttcgccgacgagccggtt
tcccgcctggacccgatcaccgcccgggacgtcgtccagttgctgacgtccgtcgccacc
gagcaccgctgcgccgtactgctggtcagccacgatcccgagctggtggacaaggtctgc
gaccgtaccctgcggctggagtag

DBGET integrated database retrieval system