KEGG   Azotobacter chroococcum: Achr_40770
Entry
Achr_40770        CDS       T03640                                 
Name
(GenBank) putative inner membrane protein translocase component YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_40770
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_40770
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_40770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acx03029]
    Achr_40770
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_40770
Mitochondrial biogenesis [BR:acx03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    Achr_40770
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_40770
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP DUF4381
Other DBs
NCBI-ProteinID: AJE23462
UniProt: A0A0C4WWW7
LinkDB
Position
complement(4588843..4590516)
AA seq 557 aa
MDIKRSILLVALAVVSYLLVLQWNQDYGQAPLPPQNAVAQNATPALPEAASATPSASVDV
PTAGSETRTLDTAVGTASPDLIQVRTDVLEVAIDPRGGDIVQLKLPQFPRRQDHPEIPFQ
LFDNGSERLYLAQSGLTGASGPDARASGRPLYVSEQRSYQLADGQDSLVVELKFSEAGVD
YTKRFTFKRGAYDLEVRHLIANHGEQPWSGNLFAQLKRDASADPSSTTATGTATYLGAAL
WTADEPYKKVSMGDMDDKSLRETVQGGWIAWLQHYFVTAWVPNKDDSNLVTTRKDSQGNY
IIGFTGPALNIPAGASGETVTRLYAGPKNQKQLEALSPGLELTVDYGFLWFIAQPIFWLL
GVIHALLGNWGWSIIVLTIIIKLAFFPLSAASYRSMGRMRAVAPKLQALKEQHGEDRQKM
SQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWLGWIVDLSIKDPY
FILPIIMGATMFFQQTLNPTPPDPMQARVMKLMPIIFTFFFLWFPAGLVLYWVVNNVLSI
GQQWYITRQIEKAAQQA
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggatatcaaacgctcgatcctgctcgtcgccctggcagtcgtgtcctacctgctggtt
ttgcagtggaaccaggattacggccaggcaccgctaccgccccagaatgctgttgcccag
aacgccacgccggccctgccggaagccgcgtccgccaccccgtcggccagcgtggacgtt
cccaccgccggcagtgaaacccggacgctggacaccgcggtgggcaccgccagtcccgac
ctgatccaggtccgcaccgatgtgctggaagtggccatcgatccgcgcggtggcgacatc
gtgcagctcaagctgccccagtttccgcgtcgccaggaccatccggagatccccttccag
ctgttcgacaacggcagcgaacgcctgtacctggcgcagagtggactgaccggcgccagc
ggtccggacgcccgcgccagcggacgtccgctgtacgtcagcgagcagcgcagctaccag
ctggccgacggacaggacagcctggtggtcgagctgaaattcagcgaggccggcgtcgat
tacaccaagcgcttcaccttcaagcgcggcgcgtacgacctggaagtccgccacctgatc
gccaaccacggcgagcagccctggagcggcaacctgttcgcccagctcaagcgcgatgcc
agcgccgacccgtcctcgaccaccgcgaccggcaccgccacctacctgggggccgcgctg
tggactgccgacgagccgtacaagaaggtgtccatgggcgacatggacgacaagagcctg
cgcgaaaccgtgcagggtggctggatcgcctggctgcaacactacttcgtgaccgcctgg
gtaccgaacaaggatgacagcaacctggtcaccactcgcaaggacagccagggcaactac
atcatcggcttcaccggtccggcgctgaacatcccggccggtgccagcggcgaaaccgtt
acccgcctgtatgccggtccgaagaaccagaagcagctcgaggccctctcgccgggcctc
gagctgaccgtcgactacggcttcctgtggttcatcgcccagccgatcttctggctgctc
ggcgtcatccatgccctgctgggcaactggggctggtcgatcatcgtcctgaccatcatc
atcaagctggccttcttcccgctctcggcggccagctaccgctcgatgggccgcatgcgc
gcggtcgcgcccaagctgcaggccctgaaggaacagcacggcgaggatcgccagaagatg
tcccaggcgatgatggagctgtacaagaaggagaagatcaacccgctcggcggctgcctg
ccgatcctggtgcagatgccggtattcctcgctctctactgggtgctgctggaaagcgtg
gagatgcgccaggcgccctggctgggctggatcgtcgacctgtcgatcaaggatccgtac
ttcatcctgccgatcatcatgggcgcgaccatgttcttccagcagacgctcaacccgacg
ccgccggatcccatgcaggcccgggtgatgaagctgatgccgatcatcttcaccttcttc
ttcctctggttcccggctggtctggtgctgtactgggtggtcaacaacgtcctctccatc
ggtcagcagtggtacattacccggcagatcgagaaggctgcgcagcaggcctga

DBGET integrated database retrieval system