KEGG   Azotobacter chroococcum: Achr_4340
Entry
Achr_4340         CDS       T03640                                 
Name
(GenBank) Cyclic nucleotide-binding protein, hydrogenase accessory protein, HoxI
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02020  Two-component system
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Achr_4340
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_4340
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acx03000]
    Achr_4340
Transcription factors [BR:acx03000]
 Prokaryotic type
  Helix-turn-helix
   CRP/FNR family
    Achr_4340
SSDB
Motif
Pfam: cNMP_binding
Other DBs
NCBI-ProteinID: AJE19940
UniProt: A0A0C4WLD8
LinkDB
Position
475660..476118
AA seq 152 aa
MESLEEILGRHPFFAGFEAEHGRLVAGCARNVRFAAGQYLFREGDPADEFFLIRHGRVAL
ELVEPGRPPVVFATLGEGEIVGASWLLPPYRWRLAARATELTRAIGIDAACLRGKCEADH
HLGYAMMKRFLPILTERLQATRLQLLDVYGKR
NT seq 459 nt   +upstreamnt  +downstreamnt
atggagagtcttgaggagattctcggccggcatcccttcttcgccggcttcgaggccgag
cacggccggctggtcgccggctgcgcgcgcaacgtgcgcttcgccgccgggcaatacctg
ttccgcgagggcgatccggccgacgagttcttcctgatccgccacggccgggtggcgctc
gagctggtcgagccgggacggccgccggtggtcttcgccaccctcggcgagggcgagatc
gtcggcgcctcctggctgctgccaccgtaccgctggcgcctcgccgcccgcgccacggag
ctgacccgggcgatcggcatcgacgccgcctgcctgcgcggcaagtgcgaggcggaccat
cacctgggctacgcgatgatgaagcgtttcctgccgatcctgacggagcgcctgcaggcc
acccgcctgcaactgctcgatgtctatgggaagcgctga

KEGG   Azotobacter chroococcum: Achr_5410
Entry
Achr_5410         CDS       T03640                                 
Name
(GenBank) Vfr transcriptional regulator / Cyclic AMP receptor protein
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
acx  Azotobacter chroococcum
Pathway
acx02020  Two-component system
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Achr_5410
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_5410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acx03000]
    Achr_5410
Transcription factors [BR:acx03000]
 Prokaryotic type
  Helix-turn-helix
   CRP/FNR family
    Achr_5410
SSDB
Motif
Pfam: cNMP_binding HTH_Crp_2 Crp TrmB MarR HTH_23 MarR_2 HTH_11 HTH_28 HTH_27 GntR RPA_C MltA HTH_24
Other DBs
NCBI-ProteinID: AJE20046
UniProt: A0A0C4WJJ8
LinkDB
Position
complement(591668..592315)
AA seq 215 aa
MVALTLLPPKLNNHDKLLAHCHRRRYTAKSTIIYAGDRCESLFFIIKGSVTILIEDDDGR
EMIIAYLNAGDFFGEMGLFDKEGSEKERSAWVRAKTECEVAEISYAKFRELAQQDPEILY
ALGRQMADRLRNTTRKVGDLAFLDVTGRVARTLLDLCKQPDAMTHPDGMQIKITRQEIGR
IVGCSREMVGRVLKSLEEQGLVHVKGKTMVVFGTR
NT seq 648 nt   +upstreamnt  +downstreamnt
gtggtcgctctcacccttcttccacccaagctcaacaatcacgacaaactgctcgcccat
tgccatcggcgccgctataccgccaagagcacgatcatctatgcgggcgaccggtgcgaa
agcctgttcttcatcatcaagggctcggtcaccatcctcatcgaggacgatgacggacgc
gagatgatcatcgcctacctgaacgccggggacttcttcggcgaaatgggcctgtttgac
aaggagggcagcgagaaggaacgcagcgcctgggtccgcgccaagactgagtgcgaagtg
gcggagatcagctatgccaagttccgcgaactggcccagcaggacccggaaatcctctat
gccctcggccggcagatggccgaccgcctgcgcaacaccacccgcaaggtcggcgacctg
gccttcctcgacgtcaccggccgcgtggcgcgcaccctgctcgacctgtgcaagcagccc
gacgccatgacccatcccgacggcatgcagatcaagatcacccgtcaggaaatcggccgc
atcgtcggctgctcgcgggaaatggtcggccgcgtgctgaagagcctggaggaacaaggc
ctggttcacgtcaagggaaagaccatggtggtcttcggcacccgctga

DBGET integrated database retrieval system