KEGG   Azotobacter chroococcum: Achr_4940
Entry
Achr_4940         CDS       T03640                                 
Symbol
trpE
Name
(GenBank) Anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
acx  Azotobacter chroococcum
Pathway
acx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acx01100  Metabolic pathways
acx01110  Biosynthesis of secondary metabolites
acx01230  Biosynthesis of amino acids
acx02024  Quorum sensing
Module
acx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Achr_4940 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Achr_4940 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_4940 (trpE)
Enzymes [BR:acx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Achr_4940 (trpE)
SSDB
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Other DBs
NCBI-ProteinID: AJE19999
UniProt: A0A0C4WJB4
LinkDB
Position
540449..541927
AA seq 492 aa
MTREEFLRLAAEGYNRIPLACETLADFDTPLSIYLKLADAPHSYLLESVQGGEKWGRYSI
IGLPARTVLRVHGYCASVSVDDVEVERHDCEDPLAFVEAFKARYRVPTLAGLPRFNGGLV
GYFGYDCVRYVEKKLAHCPNPDPLGTPDILLMVSDAVVVFDNLAGKMHLIVLADPGEAEA
FEQGQARLQALLEKLRQPLAPRQGIDLSAPPGAEPAFRASFGREDYERAVDTIKEYILAG
DCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDGL
VTVRPIAGTRPRGATEEADLALEKDLLSDAKELAEHLMLIDLGRNDVGRVADTGSVKVTD
QMVIERYSNVMHIVSNVTGQLRDGLTAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKR
GVYGGAVGYLAWNGNMDTAIAIRTAVIKDGELHVQAGGGIVADSVPALEWEETINKRRAM
FRAVALAEQGKA
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgacccgcgaagaattcctgcgactggccgccgaaggctacaaccgcattccgctcgcc
tgcgaaaccctcgccgacttcgacaccccgctgtcgatctacctgaagctcgccgacgcg
ccgcacagctacctgctggagtcggtgcagggcggcgagaagtggggccgctactcgatc
atcggcctgccggcgcgcaccgtgctgcgcgtccatgggtactgcgcctcggtcagcgtc
gacgatgtcgaggtggagcgccacgactgcgaagacccgctggctttcgtcgaagccttc
aaggcgcgctaccgggtgccgaccctggcggggctgccgcgcttcaacggcggcctggtc
ggctacttcggctacgactgcgtgcgctacgtcgagaagaagctcgcccactgcccgaac
cccgacccgctgggcaccccggacatcctcctgatggtctccgacgcggtggtggtgttc
gacaacctggccggcaagatgcatctgatcgtcctcgccgatccgggcgaggcggaggcc
ttcgagcagggccaggcgcgcctgcaggcgctgctggaaaagctgcgccagccgctggcg
ccgcgccagggcatcgatctttccgccccgcccggcgccgagccggcattccgcgccagc
ttcggccgcgaagactacgagcgcgcggtggacaccatcaaggagtacatcctcgccggc
gactgcatgcaggtggtgccctcgcagcgcatgtcgatcgacttcaaggccgcgcccatc
gacctgtaccgggcgctgcgctgcttcaacccgaccccctacatgtatttcttcaatttc
ggcgacttccacgtggtcggcagttccccggaagtgctggtgcgcgtcgaggacggcctg
gtcacggtgcgcccgatcgccggcacccgtccgcgcggcgcgaccgaggaagccgacctg
gcgctggaaaaggacctgctctccgacgccaaggagctggccgagcacctgatgctgatc
gacctgggccgcaacgacgtcggccgggtcgccgacaccggctcggtgaaggtcaccgac
cagatggtcatcgagcgctactccaacgtcatgcacatcgtctccaacgtcaccggccag
ctcagggacgggctgacggcgatggacgcgctgcgcgccatcctgcccgccggcaccctc
tccggcgcgccgaagatccgcgccatggagatcatcgacgagctggagccggtcaagcgc
ggggtctacggcggcgccgtcggctatctggcgtggaacggcaacatggacacggcgatc
gccatccgcaccgcggtgatcaaggacggcgagctgcacgtgcaggccggcggcggcatc
gtcgccgactcggtgccggcgctggagtgggaggaaaccatcaacaagcgccgcgccatg
ttccgcgccgtggccctggccgagcagggcaaggcctga

DBGET integrated database retrieval system