KEGG   Azotobacter chroococcum: Achr_540
Entry
Achr_540          CDS       T03640                                 
Name
(GenBank) Zinc uptake transcriptional regulator, Fur family
  KO
K09823  Fur family transcriptional regulator, zinc uptake regulator
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acx03000]
    Achr_540
Transcription factors [BR:acx03000]
 Prokaryotic type
  Helix-turn-helix
   Fur family
    Achr_540
SSDB
Motif
Pfam: FUR Penicillinase_R PadR Hom_end TBPIP
Other DBs
NCBI-ProteinID: AJE19569
UniProt: A0A0C4WIL3
LinkDB
Position
complement(63989..64474)
AA seq 161 aa
MTTPPLACQPHDHSHCISQALAEAETLCSRQGLRLTALRRRVLELVWQSHKPLGAYDILA
VLSEQDGRRAAPPTVYRALDFLLEHGLVHRIASLNAFVGCDHPDHTHQGQFFICRQCHAA
IELERTAISDSILDSARSLGFRVEAQTVEVVGLCARCQTAP
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaccactccgccactggcctgtcagccccacgaccacagtcactgtatcagccaggcc
ctggccgaggccgagacgctctgcagccgccaggggctgcgcctgaccgccctgcgccgg
cgcgtgctggagctggtctggcagagccacaagccgctcggcgcctacgacatcctcgcc
gtgctgagcgagcaggacggccgccgcgcggcgccaccgaccgtctaccgggcgctggac
ttcctcctcgagcacggcctggtgcaccgcatcgcctcgctcaacgccttcgtcggctgc
gaccatccggaccacacccaccagggccagttcttcatctgccggcagtgccacgcggcc
atcgagctggagcgcacggcgatcagcgacagcatcctcgacagcgcccggagcctgggt
ttccgggtcgaggcacagaccgtggaagtggtcggcctctgcgcccgctgccagacggcg
ccatga

DBGET integrated database retrieval system