KEGG   Azotobacter chroococcum: Achr_5520
Entry
Achr_5520         CDS       T03640                                 
Symbol
tyrS
Name
(GenBank) tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_5520 (tyrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acx01007]
    Achr_5520 (tyrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acx03016]
    Achr_5520 (tyrS)
   03029 Mitochondrial biogenesis [BR:acx03029]
    Achr_5520 (tyrS)
Enzymes [BR:acx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     Achr_5520 (tyrS)
Amino acid related enzymes [BR:acx01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Achr_5520 (tyrS)
Transfer RNA biogenesis [BR:acx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Achr_5520 (tyrS)
 Prokaryotic type
    Achr_5520 (tyrS)
Mitochondrial biogenesis [BR:acx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Achr_5520 (tyrS)
SSDB
Motif
Pfam: tRNA-synt_1b S4 S4_2
Other DBs
NCBI-ProteinID: AJE20057
UniProt: A0A0C4WPH6
LinkDB
Position
603130..604329
AA seq 399 aa
MRSIEEQLALIKRGADEVLVEAELVEKLKGGRPLRVKAGFDPTAPDLHLGHTVLINKLRQ
FQDLGHQVIFLIGDFTGVIGDPSGKSATRPPLTRDQVLENAETYKAQVFKILDPSKTEVV
FNSSWIEQLTPADFVRLTSHCTVARMLERDDFSKRYAANQSIAIHEFLYPLVQGYDSVAL
HADVELGGTDQKFNLLMGRELQRAYGQKSQCIVTMPLLEGVDGVKKMSKSLGNYIGIQES
PGIMYGKLVSIPDLLMWRYFELLSFRSMEEIEAFRLDVDRGANPRDIKIKLAEEIVARFH
GEEAAVNAHRSAGNRMKDGELPEDLPVIELLSTEDMPIAAVLNKAGLVRNAAMARDLLGS
GGVRVDGAVVDRSFLFQRGAAHICQAGKKSFAKVVLKAE
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaggtcgattgaagagcagttggcgctgatcaagcgcggtgcagatgaagtcctggtc
gaggctgagttggtcgaaaagctgaaaggtggccggccgctgcgagtcaaggcaggtttt
gatcccactgctccggatctgcatcttgggcataccgtactcatcaacaagctgcgccag
tttcaggacttggggcaccaagtgattttccttattggcgacttcaccggagtgatcggt
gatcccagcggtaaaagcgccacccggccacctttgactcgtgatcaagtgttggagaat
gctgaaacctacaaggctcaggtttttaagatccttgatccgagcaagactgaggtggtt
ttcaattctagctggattgagcagctgacccctgctgactttgttcggcttacctcccat
tgcacggtagcgcgcatgcttgagcgcgacgatttcagtaagcgttacgctgcaaatcag
tcgatcgcaattcatgagtttctttatcctctggtacaaggatatgactcggttgccttg
catgccgatgtcgagctgggggggacggaccagaagttcaatctgttgatggggcgcgaa
ctgcagcgtgcctatggtcagaagtctcagtgcatagtcaccatgcccctgcttgagggg
gtagatggcgtgaagaaaatgtccaagtccctgggcaattatatcggcattcaagagtcg
cctggcatcatgtatggcaagctggtgtccattcctgatttgttgatgtggaggtatttc
gagctcctgagctttcgctcgatggaggaaatcgaagcctttcggctcgatgtcgatcgg
ggagccaatccgcgggatatcaagatcaagctggctgaggaaattgttgctcgtttccat
ggcgaagaggcggcggtcaatgctcatcgttcggctggaaatcgcatgaaggatggtgaa
ctgcctgaagacttgcctgtaatcgaattgctctcgacagaggatatgccgattgctgct
gttctgaataaggcgggcttggtcaggaacgctgctatggcgcgtgatctgctcggctct
ggcggggtgagggtggatggtgctgtggttgatcgcagcttcttgttccagcgaggtgcg
gcgcatatctgtcaagcgggtaagaaatctttcgctaaggttgtcttgaaggctgagtaa

DBGET integrated database retrieval system