KEGG   Azotobacter chroococcum: Achr_6410
Entry
Achr_6410         CDS       T03640                                 
Symbol
tatC
Name
(GenBank) Sec-independent protein translocase protein TatC
  KO
K03118  sec-independent protein translocase protein TatC
Organism
acx  Azotobacter chroococcum
Pathway
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_6410 (tatC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_6410 (tatC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_6410 (tatC)
Secretion system [BR:acx02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   Achr_6410 (tatC)
SSDB
Motif
Pfam: TatC DUF5389
Other DBs
NCBI-ProteinID: AJE20140
UniProt: A0A0C4WLZ4
LinkDB
Position
complement(703116..703883)
AA seq 255 aa
MTARPDSDQDMPLVAHLTELRSRLLRSVAAVLLIFAALFYFAQDIYALVSAPLRAYLPEG
ATMIATGVASPFLAPFKLTLMISLFLAMPVVLHQVWGFIAPGLYQHEKRIAMPLMASSVL
LFYAGMAFAYFVVFPIMFGFFASVTPEGVAMMTDIGQYLDFVLTLFFAFGVAFEVPVATF
LLIWVGIVDVASLRNSRPYVIVGCFVVGMVLTPPDVFSQTLLAVPMWLLFEIGVFFGARI
RHREEPAASDGPSQP
NT seq 768 nt   +upstreamnt  +downstreamnt
atgacagcccgaccggacagcgaccaggacatgcccctggtcgcgcacctgaccgagctg
cgctcgcgcctgctgcgcagcgtggcggcagtgctgctgatcttcgccgcactcttctac
ttcgcccaggacatctacgccctggtctcggcgcccctgcgcgcctacctgccggaaggc
gcgaccatgatcgccaccggcgtggcctcgccgttcctcgcgccgttcaagctgaccctg
atgatctcgctgttcctcgccatgccggtggtcctccaccaggtctggggcttcatcgcg
ccggggctgtaccagcacgagaaacgcatcgccatgccgttgatggcctccagcgtgctg
ctcttctatgccggcatggccttcgcctacttcgtggtcttcccgatcatgttcggcttc
ttcgccagcgtgaccccggaaggcgtggcgatgatgaccgatatcggccagtacctggac
ttcgtgctcaccctgttcttcgccttcggtgtggccttcgaggtgccggtggcgaccttc
ctgctgatctgggtgggcatcgtcgacgtggcaagcctgcgcaacagtcgcccctacgtg
atcgtcggctgcttcgtggtcggcatggtcctcaccccgccagacgtgttctcccagacc
ctgctcgccgtgcccatgtggctgctgttcgagatcggcgtgttcttcggcgcgcggatc
cgccaccgcgaggagccggccgcctccgacggcccgtcgcaaccgtga

DBGET integrated database retrieval system