KEGG   Azotobacter chroococcum: Achr_9690
Entry
Achr_9690         CDS       T03640                                 
Symbol
ileS
Name
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_9690 (ileS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acx01007]
    Achr_9690 (ileS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acx03016]
    Achr_9690 (ileS)
Enzymes [BR:acx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     Achr_9690 (ileS)
Amino acid related enzymes [BR:acx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Achr_9690 (ileS)
Transfer RNA biogenesis [BR:acx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Achr_9690 (ileS)
 Prokaryotic type
   Other AARSs
    Achr_9690 (ileS)
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g zf-FPG_IleRS tRNA-synt_1_2 tRNA-synt_1e tRNA-synt_1f Phage_TAC_1
Other DBs
NCBI-ProteinID: AJE20451
UniProt: A0A0C4WK92
LinkDB
Position
1067176..1070007
AA seq 943 aa
MTDYKATLNLPETAFPMKAGLPQREPETLQRWNSIGLYRKLRQIGEGRPKFILHDGPPYA
NGNIHIGHAVNKIIKDMIVRSKTLAGFDAPYVPGWDCHGLPIEHKVETTFGKNQPADLTR
ERCRTYAAEQVEGQRADFIRLGVLGDWDNPYKTMDFANEAGEIRALAKMVEGGFVFKGLK
PVNWCFDCGSALAEAEVEYQDKKSDAIDVLFPVEEEGKLAAAFGLASLAKPAGIVIWTTT
PWTIPANQALNVHPEFTYALVDTGERLLVLAEELVEGCLARYGLQGEVLATAKGEALELI
RFRHPFYERFSPVYLADYVALDAGTGIVHSAPAYGEDDFRSCKHYGMHNDDILTPVQSNG
VYAESLPFFGGQFIWKANPNIVAKLAEVGALLKHESIQHSYMHCWRHKTPLIYRATAQWF
VGMDKQAHDGTTLRERALTAIEQTQFVPAWGQARLHGMIAGRPDWCISRQRNWGVPIPFF
LHKESGELHPRTVELMEQVARRVEQEGIEAWSRLEPAELLGEEAAQYDKIADTLDVWFDS
GTTHWHVMRGSHPMGHDQGPRADLYLEGSDQHRGWFHSSLLTGAAIDGHAPYRGLLTHGF
TVDENGRKMSKSLGNVIAPQEITDSMGADILRLWVSATDYSGEMAVSKQILQRSADAYRR
IRNTARFLLSNLNGFDPARDLLAAEDMLALDRWAVDRALLLQREIEEAFDSYRFWVVYQK
VHNFCVQELGGFYLDIIKDRQYTCAADSVARRSCQSAMYHIGEALVRWIAPILAFTAEEI
WQYLPGARNESVMLNTWYQGLSELPEGFALDRAFWEQVMAVKAAVNKELENLRVAKAIGG
NLQAEVTLFAEPALAERLALLGDELRFVLITSAAQVQPLEAAPADAVETEVGGLRIRVVK
SAHAKCARCWHHREDVGVDPAHPEICGRCVENIQGEGEVRRHA
NT seq 2832 nt   +upstreamnt  +downstreamnt
atgaccgactacaaagcgaccctcaatctgccggaaacggcgtttccgatgaaggccggc
ctgccgcagcgcgagccggagacgctgcagcgctggaacagcatcggcctgtaccgcaag
ctgcggcagatcggcgaggggcgtccgaagttcatcctgcacgacggcccgccctacgcc
aacggcaacatccacatcggccatgcggtcaacaagatcatcaaggacatgatcgtccgc
tcgaagactttggccggcttcgacgcgccctacgtgccgggctgggactgccatggcctg
cccatcgagcacaaggtggaaaccaccttcggcaagaaccagccggcggacctgacccgc
gagcgctgccgcacctacgccgccgagcaggtcgaggggcagagggccgacttcatccgc
ctcggcgtgctcggcgactgggacaacccctacaagaccatggacttcgccaacgaggcc
ggggaaatccgtgcgctggcgaagatggtcgagggcggcttcgtgttcaaggggctcaag
ccggtgaactggtgcttcgactgcggttcggcgctggccgaggcggaggtcgagtaccag
gacaagaagtccgatgccatcgacgtactcttcccggtcgaggaggaaggcaagctggcc
gccgccttcggcctggcgagcctggccaagccggccggcatcgtgatctggaccaccacc
ccctggaccatcccggccaaccaggcgctcaacgtccatccggaattcacctatgcgctg
gtcgataccggcgagcggctgctggtgctggccgaggagctggtcgaaggctgcctggcg
cgctacggcctgcagggcgaggtgctggccaccgcgaaaggcgaggccctggagctgatc
cgcttccgccatccgttctacgagcgcttctcgccggtctacctggccgactacgtggcg
ctggacgccggcaccggcatcgtccactcggcgccggcctacggcgaggacgacttccgc
agctgcaagcactacggcatgcacaacgacgacattctcaccccggtgcagagcaacggg
gtgtatgccgagtcgctgccgttcttcggcggccagttcatctggaaggccaacccgaac
atcgtcgccaagctcgccgaggtcggcgccctgctcaagcacgagagcatccagcacagc
tacatgcactgctggcggcacaagaccccgctgatctaccgcgccaccgcccagtggttc
gtcggcatggacaagcaggcccacgacggcaccacgctgcgcgagcgcgccctgaccgcc
atcgagcagacccagttcgtccccgcctggggccaggcgcgcctgcacgggatgatcgcc
ggccgtccggactggtgcatctcgcgccagcgcaactggggcgtgccgattcccttcttc
ctgcacaaggaaagcggcgagctgcatccgcgtaccgtcgagctgatggagcaggtggcc
cggcgcgtcgagcaggagggcatcgaggcgtggtccaggctcgagccggccgagctgctc
ggcgaggaagccgcccagtacgacaagatcgccgacaccctggacgtctggttcgactcc
ggcaccacccactggcacgtgatgcgcggctcgcatcccatgggccacgaccagggcccg
cgcgccgacctctacctggaaggctccgaccagcaccgtggctggttccactcgtcgctc
ttgaccggcgcggccatcgacggccatgcgccgtaccgcggcctgctgacccacggcttc
accgtggacgagaacggccgcaagatgtccaagtccctcggcaacgtcatcgccccgcag
gagatcaccgacagcatgggcgccgatatcctgcgcctctgggtgtcggccaccgactac
tccggcgagatggcggtgtccaagcagatcctccagcgcagcgccgacgcctaccggcgc
atccgcaacaccgcgcgctttttgctctccaacctcaacggcttcgatccggccagggac
ctgctggccgccgaggacatgctggcgctcgaccgctgggcggtggaccgcgccctgctg
ctgcagcgcgagatcgaggaggccttcgacagctaccgcttctgggtcgtctaccagaag
gtgcacaacttctgtgtgcaggagctgggcggcttctacctcgacatcatcaaggaccgc
cagtacacctgcgccgccgacagcgtggcgcggcgttcctgccagagcgccatgtaccac
atcggcgaggcgctggtgcgctggatcgcgccgatcctggcgttcaccgccgaggagatc
tggcagtacctgcccggcgcgcgcaacgaatcggtgatgctcaacacctggtatcagggc
ctctccgagctgccggaaggcttcgcgctggaccgtgccttctgggagcaggtcatggcg
gtcaaggccgcggtgaacaaggagctggagaatctgcgcgtggccaaggccatcggcggc
aacctgcaggccgaggtcaccctgttcgccgagccggccctggccgagcgcctggccctg
ctgggcgacgagctgcgcttcgtgctgatcacctccgccgcccaggtccagcccctcgaa
gccgccccggcggacgcggtggaaaccgaggtcggcggtctgcggatcagggtggtcaag
tcggcccacgccaagtgcgcccgctgctggcaccaccgcgaggacgtcggcgtcgacccg
gcccacccggaaatctgcgggcgctgcgtggagaacatccagggcgaaggcgaggtccgc
cggcatgcgtga

DBGET integrated database retrieval system