KEGG   Azotobacter chroococcum: Achr_9970
Entry
Achr_9970         CDS       T03640                                 
Symbol
secD
Name
(GenBank) Preprotein translocase subunit SecD
  KO
K03072  preprotein translocase subunit SecD
Organism
acx  Azotobacter chroococcum
Pathway
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_9970 (secD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_9970 (secD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_9970 (secD)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_9970 (secD)
SSDB
Motif
Pfam: SecD-TM1 SecD_SecF MMPL Sec_GG
Other DBs
NCBI-ProteinID: AJE20478
UniProt: A0A0C4WGY6
LinkDB
Position
1103248..1105116
AA seq 622 aa
MLNKYPLWKYLLILAVLLVGIVYSAPNLFPDDPAIQISGASTARPIGQGDLERVGKALAE
AGIAVKASSLANEGKAGLVRLTDQEHQLRAKDVARKVLGDEYVVALNLAPTTPGWLRALG
ASPMKLGLDLSGGVHFLLEVDMDKALDARLKVYESEVKSLLRKERQRYRSLPQQDGAIQL
GFADSEQLEQAQALIRKNFSDFELATAERNGLQVLRLEMTPAKLAEIREYSIKQNLTTVR
NRVNELGVSEPLVQRQGANRIVVELPGVQDTAEAKRILGKTANLEFRMAAEPDAVRAMTE
TFEFREEGRPPVALERSLIITGDQVTDAQAGYDENGRPQVNIRLDGHGGELMNRATRNSV
GRSMAVLFIEQKPVTRYVKQTVDGVEQEVAVETFREERKIISLATIQSALGSQFRITGLD
GQGESSELALLLRAGGLAAPMYFAEERTLGPSLGAENIQLGIQASLWGFLFVGLFILVIY
KFFGLLAAVALAFNMVLLVALMSLLGATLTLPGIAGIVLTMGMAVDANVLIFSRIREEIA
NGLSIQRAIHEGFDRAFSAILDGNLTTLLVGGILFAMGTGPVKGFAVTMSLGILTSLFTA
IMVTRGLVNLIYGGRDLKKLWI
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgctcaacaagtatcccctgtggaagtatctgctgatcctggccgtgctgctggtcggc
atcgtctattccgcacccaatctgtttcccgacgacccggccatccagatcagcggggca
agcacggcccggccgatcggacagggcgatctcgagcgtgtcggcaaggcgctggccgag
gccggcatcgccgtcaaggcgagcagtctggccaatgagggcaaggccgggctggtgcgc
ctgactgatcaggagcaccagctgagggccaaggatgtggcgcgcaaggtgcttggcgac
gagtacgtggtggcgctgaacctggcgccgaccacgcccggctggctgcgcgcgctgggc
gccagtccgatgaagctgggcctggacctgtccggtggtgtgcacttcctgctcgaggtg
gacatggacaaggcgctggatgcgcgcctgaaggtgtatgagagcgaagtgaagagcctg
ctgcgcaaggaacgtcagcgctaccgcagtctgccgcagcaggacggcgccatccagctg
ggctttgccgacagcgagcagctggagcaggcccaggcgttgatacgcaagaatttcagc
gatttcgagctggccaccgccgagcgcaacggtctgcaggtgctgcgcctggaaatgacc
ccggcgaagctcgcggagatccgcgaatactcgatcaagcagaacctgaccacggtgcgc
aaccgggtcaacgagctgggcgtgtccgagccgctggtgcagcgccagggggccaatcgc
atcgtggtcgaactgcccggcgtgcaggacaccgccgaggccaagcggattctcggcaag
accgccaacctggaattccgcatggccgccgagcccgatgccgtgcgcgccatgaccgaa
accttcgagttccgcgaggaggggcgtccgccggtggcactggagcgcagcctgatcatc
accggcgaccaggtcaccgacgcccaggctggctatgacgagaacggccgtccgcaggtg
aacatccgtcttgacggccacggtggcgagctgatgaaccgggcgacccgcaacagcgtc
gggcgcagcatggcggtgctgttcatcgagcagaagccggtgacccgctacgtcaagcag
acggtcgacggcgtcgagcaggaagtggcggtcgagaccttccgcgaagagaggaagatc
atcagcctggcgaccatccagtcggcgctcggcagccagttccgcatcaccggcctcgac
ggccagggcgaatcctcggagctggcgctgctgctgcgcgccggcggcctggcggcgccc
atgtacttcgccgaggagcgcaccctgggcccgagcctgggggcggagaacatccagctg
ggcatccaggcctcgctgtggggcttcctgttcgtcggcctgttcatcctggtcatctac
aagttcttcggcctgctggccgccgtggcgctggccttcaacatggtgctactggtggcg
ctgatgtcgctgctcggcgcgaccctgaccctgccgggcatcgccggcatcgtgctgacc
atgggcatggcggtggatgccaacgtgctgatcttctcgcgcatccgcgaggagatcgcc
aatggcctgtcgatccagcgggccatccacgagggcttcgaccgcgccttctcggcgatt
ctcgacggcaacctgaccaccctgctggtgggcggaattctcttcgccatgggcaccggg
ccggtcaagggcttcgccgtgaccatgtcgctggggatcctcacctccctgttcaccgcc
atcatggtgacccgtggcttggtcaacctgatctacggtggtcgcgatctgaagaaactg
tggatttga

KEGG   Azotobacter chroococcum: Achr_9980
Entry
Achr_9980         CDS       T03640                                 
Symbol
secF
Name
(GenBank) preprotein translocase subunit SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
acx  Azotobacter chroococcum
Pathway
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_9980 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_9980 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_9980 (secF)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_9980 (secF)
SSDB
Motif
Pfam: SecD_SecF Sec_GG
Other DBs
NCBI-ProteinID: AJE20479
UniProt: A0A0C4WK43
LinkDB
Position
1105127..1106041
AA seq 304 aa
MKRVINFMGIRRAAFIATLLLTLVSLASLAIRGLNFGLDFTGGTLIELNYERPVELSSVR
AKLDEAGYGDALVQSFGATTDVLVRLQGDDPQLGDKLAAALRQSASDNPATVKRVEYVGP
AVGEELRDQGGLGMLLALGGILVYVAFRFQWKFGCGAVLSLFHDVIVTLGVFSFFQIPFD
LTVLAAVLAIIGYSLNDTIVVFDRIRENFRLLRKTELIENINISTTQTLLRTMATSVSTL
LAVMALMLFGGEALWGFSLALFIGVAAGTYSSVYIANLTLVWLKLTRDDLIPPVAEETEA
DLRP
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaagcgtgtaatcaatttcatgggtatccgccgggcggccttcatcgctaccctgctg
ctgaccctggtgtcgctggccagcctggcgatcagggggttgaatttcggcctggacttc
accggcggcaccctcatcgagctgaactacgagcgtccggtcgagctgtcgagcgtgcgt
gccaagctggacgaggccggctacggcgatgccctggtgcagagtttcggggcgaccacc
gacgtgctggtgcgcctgcagggcgacgatccgcagctgggcgacaagctggcggcggca
ctgcgccagtccgcctccgacaacccggcgacggtcaagcgtgtcgagtacgtcggtccg
gcggtgggcgaggagctgcgcgaccagggtggtctgggcatgctgctggcgctgggtgga
atcctggtctacgtggccttccgcttccagtggaagttcggctgcggcgccgtgctttcg
ctgttccacgacgtcatcgtcaccctcggcgtgttctccttcttccagatccccttcgac
ctcacggtgctggcggcggtgctggcgatcatcggctattcgctgaacgacaccatcgtg
gtgttcgaccgcatccgcgagaacttccgtctgctgcgcaagaccgagctgatcgagaac
atcaacatttccacgacccagacgctgctgcgcaccatggcgacctcggtttccaccctg
ctggcggtgatggcgctgatgctgttcggcggcgaggcgctgtggggcttctccctggcg
ctgttcattggggtggcggcagggacttattcctcggtctacatcgccaacctcacgctg
gtctggctgaagctgactcgcgacgacctgatccccccggtcgccgaggagaccgaggcg
gacctgcgcccctga

DBGET integrated database retrieval system