KEGG   Azotobacter chroococcum: Achr_c180
Entry
Achr_c180         CDS       T03640                                 
Symbol
traG
Name
(GenBank) Conjugal transfer coupling protein TraG
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_c180 (traG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_c180 (traG)
Enzymes [BR:acx01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Achr_c180 (traG)
Secretion system [BR:acx02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Achr_c180 (traG)
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: AJE23499
UniProt: A0A0C4WS60
LinkDB
Position
pAcX50c:15614..17530
AA seq 638 aa
MISKDKFNNAVGPQVRAKKSGVGKAVPALALLSIGVGLAASTQFFAYDLNYQEVLGPHFN
HVYAPWSILTWANKWYGIYPDAFMRAGSIGVLATGVGLLGLVVTKMISANSSKANEYLHG
SARWAGKKDIQAAGLLARPRRFLEVLTGKSAPSHSGVYVGAWVDNKGVQHYLRHNGPEHV
LTYAPTRSGKGVGLVVPTLLSWSDSTVITDLKGELWALTAGWRQKHARNKVLRFDPASSN
GGVRWNPLDEIRIGTENEVGDVQNLATLIVDPDGKGLDSHWQKTSQALLVGLIMHVLYKS
KNEGTPATLPEVDRNLADPDRDIGDLWMEMVTYSHVNGRNHPLVGSAARDMMDRPEEEAG
SVLSTAKTYLALYRDPVVAQNVSASEFKVKDLMNHDNPVSLYIFSKPNDKARLRPLVRVL
INMIVRLLADKMDFENGRPVAHYKHRLLMMLDEFPSLGKLEILQESLAFVAGYGIKCYLI
CQDINQLKSREIGYGHDETITSNCHVQNAYPPNRVETAEHLSKLTGQTTVVKEQITTSGR
RTSALLGQVSRTIQEVQRPLLTPDECLRMPGPLKIASGDISEAGDMVVYVAGYPAIYGKQ
PLYFKDPVFQTRAAIPAPKNSDKLRIVQEVTAAEAITI
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgatttcaaaagacaaattcaacaatgccgttggcccgcaagtgcgggccaaaaagagc
ggggtagggaaagcggtgcctgctctggccctattgtctatcggtgtcggcctagctgcg
tccactcagttctttgcctacgatctcaactaccaagaggtattaggcccgcacttcaat
catgtctatgcgccctggtcaattctgacttgggcaaacaaatggtatggcatttatccc
gatgcgttcatgcgggcaggaagcatcggggtgctggctacaggcgttggcttgcttggt
ctggtcgtgaccaagatgatttcggctaacagttccaaagcgaacgaatacctgcatggc
tcggcccggtgggccggcaagaaggacattcaggcagctggtttgctggctcggcctcga
cgcttcctggaagttctgaccggcaaaagcgcacccagccactccggggtttatgtaggc
gcatgggtggacaataaaggggtccagcattacctgcgccacaacggcccggagcacgtc
ctgacctatgccccaacgcgctcgggtaaaggcgttggccttgtagtacccaccctgttg
tcctggtcagacagcaccgtaattaccgacctcaagggcgagctatgggctttgacggcc
gggtggcgacagaagcacgctcgcaacaaggttttgcggttcgatcctgccagcagcaac
ggtggagtccgctggaatccgctcgatgaaatccgtattggcaccgaaaacgaagttggt
gacgtgcagaacctggcaactctgatcgtggacccggacggcaaaggcttggatagccac
tggcagaagaccagtcaggcgctgctggtcggcctcatcatgcatgttctttataaaagc
aagaacgaggggacgcccgcgaccctgccagaagtggaccgtaacttggctgatccagac
cgcgatattggcgacttgtggatggaaatggtcacctacagccatgtcaacggtcgcaat
cacccacttgtaggctcagcagcccgcgacatgatggaccgtcccgaggaagaagctggt
tcggtcctgtccacggccaagacttacctggccctttaccgcgacccggttgttgctcag
aacgtcagcgcgtcggagttcaaggtgaaagacctcatgaaccacgacaacccggtcagc
ctttacatcttctcaaagccgaacgataaggctcggctgcggcctctggtgcgcgtgctc
atcaatatgatcgtgcggctgctggccgacaagatggacttcgagaacgggcgtccggtg
gcgcactacaaacaccgattgctgatgatgcttgatgagtttccaagcctcggcaagctg
gaaatcctgcaagaatcgctggcgttcgtcgccggctacggtatcaagtgctacctgatt
tgtcaggacattaaccagctcaagagccgtgaaatcggttacggccacgacgagacgatc
acctcgaactgccacgtccagaacgcttacccgccgaaccgggttgaaaccgctgaacac
ctatcaaagctcactgggcaaaccaccgtggtcaaagagcagatcacgaccagtggccgg
cgaaccagcgccctgttgggtcaggtgtccaggacgatacaggaagtgcagcgcccacta
ctgaccccggacgagtgtctgcggatgcccggcccgctcaagatcgcctctggcgacata
tccgaggctggcgacatggttgtttacgtcgcgggctacccagccatctacggcaagcag
cctctgtacttcaaagaccctgtttttcagaccagggccgcaataccggcgccgaagaac
agcgacaagctgcgcatagtccaggaagtgacagcagctgaggcgatcacgatatga

DBGET integrated database retrieval system