KEGG   Azotobacter chroococcum: Achr_c450
Entry
Achr_c450         CDS       T03640                                 
Symbol
trbL
Name
(GenBank) Mating pair formation protein TrbL
  KO
K07344  type IV secretion system protein TrbL
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_c450 (trbL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_c450 (trbL)
Secretion system [BR:acx02044]
 Type IV secretion system
  Trb secretion system protein
   Achr_c450 (trbL)
SSDB
Motif
Pfam: TrbL DUF2976
Other DBs
NCBI-ProteinID: AJE23526
UniProt: A0A0C4WS26
LinkDB
Position
pAcX50c:complement(52403..53752)
AA seq 449 aa
MRMSAVMKNATLPLFVGLAFFTFTVDVHAAIDNAGLLDTVLERYSAAAGTWATFIKDAAS
RLFWLLVVISMVWTFGMMALRKADIAEFFAEFIRFTIFTGFFWWLLTNGPAFADAIMRSL
RQLAGEATGLGGTLSPSGIVDIGFEIFGKVLDQSSVWAPVDSACGIILAGIILVILALIG
VNMLLLLISGWILAYAGVFFLGFGGSRWTSDMAVNYYKTVLGVAAQLMSMVLLVGIGKTF
LDDYYNAMSEGIKLKEMGVMLIVAVILLVLTNKIPQLISGIITGASVGGAGIGNFGAGAA
VGTTGMVVAAAATGGAALASGAANISGGAQALMAAFNSAQNNVAASTDITSKVAGAFSSD
NSATGGSSPLASAMGLGSTGSITSFGTPSFESTAGGNASESGSQQADKGSSKLGTAGRIA
ADMSANLAGGIGRMAKDKALDMVIQRRPA
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaggatgtcagccgtcatgaagaatgccactctaccgttgttcgttgggctagccttt
tttacctttaccgtagatgttcatgccgcgattgataacgcagggctccttgatacggtc
ttagagagatacagcgcggcagccggcacatgggctacctttatcaaagacgcggcgagc
cgcttgttctggctgcttgttgtgatctcgatggtctggacattcggcatgatggctttg
cgcaaagcggacattgccgaattctttgcggagtttattcggttcactatttttactggc
ttcttctggtggctacttactaacgggccagcctttgcggatgcaattatgcgatcactt
cgccaactggccggtgaagcaactggccttggcgggacactatctccatcagggatcgtt
gatatcgggtttgagattttcggcaaagttctcgatcagtcctcggtttgggcgccggtc
gatagcgcgtgcgggattatcttggccgggatcatcttagtcatcctggcgttgatcggc
gtaaacatgctgctgctcttaatctccgggtggattcttgcttacgcaggagtcttcttc
ttgggtttcggcggctcgcgctggacttcggatatggctgtcaattattacaaaacagtc
ctcggcgtcgctgcccaacttatgtctatggtgctcttggtaggcatcggcaaaaccttc
cttgacgactattacaatgcgatgagcgaaggtataaagctcaaggaaatgggcgtaatg
ttgatcgtcgcggttattctgttggttctgacgaataaaattcctcaactcatctctggg
attattactggcgcgagcgttggcggcgccgggatcggcaactttggagcaggcgcagca
gttggcacgaccggcatggtggtcgctgccgccgcgactggcggcgcagcactcgcatcc
ggtgctgccaatatctccggtggtgctcaagcattgatggcagctttcaacagtgcgcaa
aacaacgtcgcagccagcactgacattacctctaaagtcgcaggagcctttagcagcgac
aattccgccactggtggtagcagtccgcttgcttccgctatgggcttgggcagtaccgga
agcattacatcgtttggcacaccatcttttgagtctaccgcaggtgggaatgcctccgag
tcgggtagccaacaagccgataagggttctagcaagctcgggactgctggccggatcgct
gccgatatgagtgccaacctggcaggtggcatcgggcggatggccaaggacaaagctctc
gacatggtgattcagcgaaggccagcgtag

KEGG   Azotobacter chroococcum: Achr_c470
Entry
Achr_c470         CDS       T03640                                 
Symbol
trbJ
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_c470 (trbJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_c470 (trbJ)
Secretion system [BR:acx02044]
 Type IV secretion system
  Trb secretion system protein
   Achr_c470 (trbJ)
SSDB
Motif
Pfam: T4SS ABC2_membrane_3 AAA_32 BAR_3 RraB DUF2188 ALMT
Other DBs
NCBI-ProteinID: AJE23528
UniProt: A0A0C4WL44
LinkDB
Position
pAcX50c:complement(54014..54799)
AA seq 261 aa
MKLSLAAKTARILFLVISAGSLQVANAGIPVIDGSNLTQNYMTAFESVAQTLKQIEQYAK
QVEQYQTQLQQYENQIQNTAAPAAYIWDQASNTINKLIAAQDMLTYYQNKAGSLDAYLGK
YQDVAYYRSSPCFSGGGCTPEAREAMAENRRLANESQKEANAALFKGLAQQQENMKEDAV
QLERIQDAASTADGQVKAIQYANQIASQQANQLLQIRGLMVAQQNAIVARNQAVQDREAQ
ETASSEQIRSGTYRNSPARDW
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaagttatctttagctgctaaaactgctcgaattctcttcctggttattagcgctgga
tcgctccaggtggcgaacgccggtattccagtaatagacggatcgaacctgacgcaaaac
tatatgaccgcgtttgaaagcgtggcacagacgctcaagcaaattgagcaatacgccaag
caggtagagcagtatcaaactcaacttcaacaatacgaaaaccaaatccagaacacggcc
gcgcctgcggcttacatctgggatcaggccagcaatacgatcaacaagcttatcgcagcg
caggatatgttgacctattaccagaacaaggccggaagtctggacgcctacctaggcaaa
tatcaggacgttgcctattaccgcagttccccatgcttcagcggggggggctgcacgcca
gaggcgcgagaggcgatggcagaaaaccgccgtctggccaacgagtcgcagaaggaggca
aatgcagctctcttcaaagggctggcccagcagcaagagaatatgaaagaagatgccgtt
cagttggagcgtatacaagatgccgcttcgaccgctgatggacaggttaaagctatccag
tacgccaaccagatcgccagccagcaagctaaccagttactccagattcgcggcctgatg
gttgcccagcagaatgcaatcgtggcgcgcaatcaggcagttcaagaccgcgaagctcaa
gaaactgcttcgtcggaacagatccgctcaggcacatatcgcaatagtcctgctcgggac
tggtaa

KEGG   Azotobacter chroococcum: Achr_c480
Entry
Achr_c480         CDS       T03640                                 
Symbol
trbI
Name
(GenBank) TrbI mating pair formation protein
  KO
K20533  type IV secretion system protein TrbI
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_c480 (trbI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_c480 (trbI)
Secretion system [BR:acx02044]
 Type IV secretion system
  Trb secretion system protein
   Achr_c480 (trbI)
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: AJE23529
UniProt: A0A0C4WS84
LinkDB
Position
pAcX50c:complement(54823..56238)
AA seq 471 aa
MSTATDDQMSPDASPGELSKKTGVRRVNNWPMYILGGAGLTFLIVMMLVAADRAAQQKQP
APAPAEKGGNTSMFAQEIAGNHTSGIIPPEATKPPEVPELTVPDASQAAPTPGALAVVRP
DDLDKPPVPPSRERTREDDELERIRMAKMQQFQEAVKAKTTVQVVAPRSSGSSNSDATLP
ANQEEALARIAAARQRLQTEAQSDPTAAYQARLEQLRGAGIGGTSDSMGGTSDSSDDSPF
LTQVSNSSRNSYDQFSNRQGGDRWELQSRTEAPRSPFELRAGFVVPATLISGINSDLPGQ
IMAQIAQDVYDTPTGRHLLIPQGSRLVGEYSSNVAYGQSRVLVAWQRIVFPDGKAMDIGS
MSGADSAGYSGFKDRVKNHYLRLFGSALFMSAVTAGISLSQDNNSSGFENETTASSAMSE
ALGQQLGQATAQLISKNANIAPTLDIRPGFRFNVMVTKDMTFSKPYKSFDY
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgagcactgccactgacgatcaaatgtctccggatgcctcgcctggggagctatccaag
aaaactggagttcgccgtgtcaacaactggcccatgtatatcttgggcggtgctggcctg
acgttcctaatcgtgatgatgcttgtagctgcggatcgagcagcacagcagaagcaaccc
gcaccagcccctgcggagaagggcggcaatactagcatgtttgcccaggaaattgcgggt
aatcacactagcgggatcatccccccggaggctaccaagccgcccgaagttcccgagcta
actgtccctgacgctagccaggctgcccccacgcccggcgccctcgcggttgttcgcccg
gatgacctcgataagccaccagtcccacctagccgtgagcgcacccgtgaagacgacgag
ttggagcgcatccgtatggcgaagatgcagcaattccaggaagcagtgaaagcgaaaact
actgtccaagtcgtggcgcctcgcagctctggctccagcaactccgacgctaccctgccc
gccaaccaggaagaagccttggcgcgtattgcagccgctcgccagcgccttcaaaccgaa
gcccaatccgacccaacagcggcctatcaggcacgtctcgagcaattgaggggcgcaggt
attggcggcactagcgacagtatgggcggcacctccgacagctcggacgattcgcctttc
ctgacgcaagtgagcaacagcagccgcaacagctatgaccagttcagcaacaggcagggt
ggcgaccgctgggaactccagtctaggaccgaggccccccgctcaccattcgagctgcgt
gctggcttcgtagtgcccgcaacgctcatttccggcatcaattccgatttaccgggccaa
atcatggctcagatcgcccaagatgtgtacgacacgcctaccggtcggcatctgctgatt
ccacaaggttctcgcctggtgggcgagtactcaagcaacgtggcctatggtcagtctcgc
gttctcgtcgcctggcaacgcattgttttccctgacgggaaagccatggatatcggctcc
atgtcgggtgccgatagtgcgggctactcggggtttaaggatagagtcaaaaaccattat
ttacggttgttcggctcggccctattcatgtcggcagtgacggccggaatttcacttagc
caagacaacaatagtagtggcttcgaaaatgaaacaactgccagtagtgcaatgagtgag
gcgcttggccagcagctcggccaagccacagcacagctcatatcaaagaatgccaacatt
gcgccgacgctggatattaggcccggatttcgctttaacgtaatggtgacaaaagatatg
acattttcgaagccctataagtcttttgactattaa

KEGG   Azotobacter chroococcum: Achr_c500
Entry
Achr_c500         CDS       T03640                                 
Symbol
trbG
Name
(GenBank) Conjugal transfer protein TrbG
  KO
K20532  type IV secretion system protein TrbG
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_c500 (trbG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_c500 (trbG)
Secretion system [BR:acx02044]
 Type IV secretion system
  Trb secretion system protein
   Achr_c500 (trbG)
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: AJE23531
UniProt: A0A0C4WS31
LinkDB
Position
pAcX50c:complement(56701..57591)
AA seq 296 aa
MKKILPAILVSLASATALAAPGDNTADLYFSTNNPTLTPQEKAAIEISQRWQKASATGIK
PVDSGDGYVRFIFGAQQPSIVCAVLQVCDVALQAGEQVNSINLGDTARWAVEPAITGFGA
SEVQHLIIKPMDVGLETSLVVTTNRRTYHFKLRSHRTQYMPQVAFTYPEEALAKWEAIKR
HETVERQKATIPETGEYLGNLSFNYSISGSTSWKPVRVYNDGVKTIIEMPKTMTQTEAPT
LLVVRKDGGWFKDDETVMVNYRVQSNRFIVDTIFDKAILIAGVGKSQDRVTIQRGE
NT seq 891 nt   +upstreamnt  +downstreamnt
atgaaaaagatccttcctgcaatccttgtcagcctggcgtctgcaactgctttggctgct
cccggcgacaacactgccgacctgtatttttcgaccaacaacccgaccctgaccccacaa
gaaaaggcggctatcgagatttcccagcgctggcagaaggcaagcgcgaccggcatcaag
ccagttgattcgggtgacggctatgtacgcttcatcttcggtgcccagcagccaagcatt
gtttgtgcagtgctccaggtctgcgatgtggcactccaagctggcgaacaagtgaactcg
atcaacctgggtgataccgcccgctgggcggtcgagccggccattaccggcttcggtgca
agcgaggtccagcacctcattatcaaaccgatggatgtgggtctagaaaccagcttggtc
gttacaaccaatcgccgtacctaccatttcaagctgcggtcccatcggacgcaatacatg
ccgcaagtcgccttcacctaccccgaagaggccctggccaagtgggaggccatcaagcgc
catgagacagtcgaacgccagaaggcgacgattccagaaacgggcgagtacctgggcaat
ctgagcttcaattattcaattagtgggagcacctcctggaagcctgtgcgcgtctacaac
gatggtgtcaagaccatcatcgaaatgcccaagaccatgacacaaaccgaagcgccgacc
ctgctggtcgtgcgtaaggacggcggctggtttaaggatgacgaaacggtgatggtcaac
taccgcgtccaaagcaaccgcttcatcgtggataccattttcgacaaagccatccttatc
gccggcgtcggcaagtctcaagatcgcgtgaccatccagcggggagaataa

KEGG   Azotobacter chroococcum: Achr_c510
Entry
Achr_c510         CDS       T03640                                 
Symbol
trbF
Name
(GenBank) TrbF mating pair formation protein
  KO
K20531  type IV secretion system protein TrbF
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_c510 (trbF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_c510 (trbF)
Secretion system [BR:acx02044]
 Type IV secretion system
  Trb secretion system protein
   Achr_c510 (trbF)
SSDB
Motif
Pfam: VirB8
Other DBs
NCBI-ProteinID: AJE23532
UniProt: A0A0C4WX32
LinkDB
Position
pAcX50c:complement(57603..58370)
AA seq 255 aa
MSFADTLKRFVLKKPADTDPQRLSGPMAGSRRNRETENPYLAARRTWNNHDSSLVSSRQA
WQVIGILSLMIALAGVGGIIHIGSQSKFIPYIVQVDKLGQSVAYGRADRAGEADQRVIAA
RIASFIADARVVTPDVKLQRDAVFRTYSVLAPNDPSTKKMNEWLNGDAEASPFKRAAKET
VSIEIRSVMPQTAETWQVDWVETTRDRQGVKKSEGTYRALVTVYQAEPNINTKEEEMWMN
PIRLFVRDFTWSKQI
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagctttgcagataccctaaagcgcttcgtactcaaaaagcctgccgacaccgatcct
cagcgcttgagcggaccaatggcaggcagccgccgcaacagggaaaccgaaaacccctat
ctagcagctcggcgtacttggaataaccatgattccagtctggtcagctcccgtcaggcg
tggcaggtcattggcattctctctttgatgatcgcgctggctggtgtgggcggcatcatc
catatcggtagtcagtctaagttcattccttacatcgtccaggtggacaagctgggccaa
tcggtcgcctacggccgtgctgatcgtgcaggtgaggccgatcagcgcgtaatcgcagct
cgaatcgcctccttcatcgctgacgcccgagttgttacgccagatgtaaagctgcaacga
gacgcggtgttccgcacctactcagtgcttgctccgaacgatccgtccacaaaaaaaatg
aacgaatggctgaatggcgacgcggaggccagcccattcaagcgggccgcgaaggaaacc
gtgtccatcgaaatcaggtcggtgatgccccaaacggccgaaacctggcaggttgattgg
gtggaaaccactcgcgaccggcagggcgtgaagaaatccgaaggcacttatcgcgccttg
gtcacggtgtaccaggccgaaccgaacataaacacgaaagaagaagaaatgtggatgaac
ccgatccggctgttcgtccgcgacttcacttggtccaagcaaatctga

KEGG   Azotobacter chroococcum: Achr_c520
Entry
Achr_c520         CDS       T03640                                 
Symbol
trbE
Name
(GenBank) type IV secretion/conjugal transfer ATPase, VirB4 family protein
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_c520 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_c520 (trbE)
Enzymes [BR:acx01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Achr_c520 (trbE)
Secretion system [BR:acx02044]
 Type IV secretion system
  Trb secretion system protein
   Achr_c520 (trbE)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 ABC_tran Zeta_toxin AAA_29
Other DBs
NCBI-ProteinID: AJE23533
UniProt: A0A0C4WL50
LinkDB
Position
pAcX50c:complement(58367..60925)
AA seq 852 aa
MIEGIAYAIAALGALLLLILVSRLRQVDADLKLKKHRSKDAGLADLLIHAAVVDDGVIVG
KNGALMAAWLYQGDDNASSTEEQRELVSLRINQAFAGLGNGWMVHLDAVRRPAPNYSPRN
VSHFLDPLTAAIDEERRALFESMDTMYEGYFVLTVTYFPPMLAQQKFVEMMFDDDADVPD
HKARTHNLLEQFKRDCAGMESSLSSIFKMTRLKGNKIELEDGQVVTHDDFLSWLQFCITG
ITQPVMLPSNPMYLDAIIGGKELWGGVVPKVGRNFIQAVAIEGFPLESSPGLLAALAELP
CEYRWSNRFIFMDTHEAVRHLEKFRKKWKQKVRGFFDQVFNTNTGAIDQDALNMVQDAAN
AIAEVNSGLAAQGYYTSVVILMDEDRSRLEESARMVEKAIERLAFAARVETINTMDAYLG
SIPGHGVENVRRPLINTMNLADLLPTSSIWTGSADAPCPLYPPLSPALMHCVTQGATPFR
LNLHVRDLGHTFMFGPTGAGKSTHLAILAAQFRRYLGMSIFAFDKGMSMYPLAAGIRAKT
KGVSGLHFTVAADDDRLAFCPLQFLETKADRAWAMEWIDTILALNGLETNAAQRNEVGYA
IMTMHRDGSRTLSDFCVTVQDEQIRETLRQYTVDGSMGHLLDAEEDGLSLSDFTVFEIEE
LMNLGNKYALPVLLYLFRRIERALKGQPSVIILDEAWLMLGHPVFREKIKEWLKVLRKAN
CLVLMATQSLSDAANSGILDVIVESTATKIFLPNVFARDQDTIALYRRMGLNTRQIEILA
TAVAKRQYYYVSEQGRRLYDLALGPLALAFVGSTDKESVALIKNLERKFGDAWVDEWLAG
RGLRFNDYGVTA
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgatcgaaggtattgcgtatgcaattgctgccctcggtgccttgcttctgctgatcctt
gtttcacgtctacgccaggtggacgcagatttgaagctcaagaagcatcgctccaaggat
gcagggctagccgatctgttgatccatgccgctgttgtcgatgacggcgtgatcgtcggt
aaaaatggcgccctaatggccgcatggctctatcaaggcgacgacaatgccagcagtacc
gaggaacagcgcgagctggtatctctcagaatcaaccaagcatttgccggcctgggcaac
ggctggatggttcatctggacgccgttcgccgtccagcaccgaactactcgcctcgcaat
gtctcgcacttccttgatccactaacggccgcgatagatgaagaacgtcgcgccctattt
gaaagtatggacacgatgtatgaaggttatttcgtcctgaccgtcacctatttcccgccg
atgctcgcccagcagaagtttgtggagatgatgttcgatgacgacgcggacgtacctgac
cacaaggcccggacgcacaatctccttgaacagttcaagcgcgattgcgccggcatggaa
agcagcctgtcgtcaatttttaagatgacccgcctgaagggcaacaagattgagctggaa
gatgggcaagtggtcacgcacgatgacttcctgagctggctgcaattctgcatcactggc
attacccagccggtcatgctgccaagcaatccgatgtacctggacgcgatcattggcgga
aaagagctatggggcggggtagtgcccaaggttggccgaaacttcatccaagcggtggct
atcgagggctttccgctcgagtcgtcgcccggcctactcgctgcactggccgaactgcct
tgcgaatatcgttggtcaaaccgcttcatcttcatggatacccatgaggccgtaagacac
ctggagaagtttcgcaaaaagtggaaacagaaagtccgtggcttctttgaccaggttttc
aacaccaacaccggagctatcgaccaagacgcgctgaatatggttcaggacgcggctaac
gcgattgccgaggtcaacagcggattggccgcgcagggttactacaccagcgttgtcatt
ctaatggacgaagaccgtagtcggctcgaagaatcggcccgcatggtggaaaaggccatc
gagcgcttggcattcgcggcccgcgtcgaaaccatcaacacgatggatgcctacctaggc
agtatccccggccacggagtagagaacgtgcgccgcccgctcatcaatacgatgaacctg
gccgatttgttgccgaccagcagcatctggacaggctctgccgacgctccatgcccattg
tatccgccactttcgcccgccctgatgcattgcgtcacgcaaggcgcgaccccgttccgt
ctaaacctccatgtccgcgacttgggccatacattcatgttcggaccgaccggcgctggt
aaatcaacccacctcgctatcctggccgcgcagtttcgccgttacctgggcatgtcgatc
ttcgcttttgacaagggcatgtccatgtaccccctcgccgcaggcatccgtgccaaaaca
aaaggtgtgtcgggcctgcacttcacagttgcagccgatgacgacaggcttgcgttctgc
ccgcttcaattcctggagacgaaggctgatcgagcctgggcaatggagtggatcgacacc
attctggcgttgaatggtctggagacgaatgccgcgcagcggaacgaagtcggctacgcc
atcatgacgatgcaccgcgacggctcgcgcaccctgtctgatttttgcgtcacggtccag
gacgagcagatccgggaaactctgcgccaatacaccgtcgatggttcgatgggccacctg
ttggatgccgaggaagacggtctgtcgctatctgacttcactgtctttgaaatcgaagag
ctgatgaacctgggcaataagtatgcgcttccggtcctgctctacctgttccgacgcatc
gagcgtgccttaaaaggccagccctcggtcatcatcttggacgaagcctggctgatgctc
ggccacccggtattccgagagaaaatcaaagaatggctcaaggtgttgcgtaaggccaac
tgcttggttctgatggccacgcaaagcctttccgacgcggccaactccggcattctagac
gtgatcgttgaatcgaccgcgaccaagattttcctgcccaacgtctttgctcgcgaccaa
gacaccatcgcactgtatcgccgtatgggcctcaatacccgtcaaatcgagattctggcg
accgctgttgcgaaacggcagtactactacgtttccgagcaaggccgccgcctctatgac
ctcgccctaggccctctcgcgctcgcctttgtcggttccaccgacaaggaatccgttgcc
ctcatcaagaatctagaacgcaaattcggcgatgcctgggtcgatgaatggctggctgga
cgtggcctgagattcaatgattatggagtgacagcatga

KEGG   Azotobacter chroococcum: Achr_c530
Entry
Achr_c530         CDS       T03640                                 
Symbol
trbD
Name
(GenBank) Conjugal transfer protein TrbD
  KO
K20529  type IV secretion system protein TrbD
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_c530 (trbD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_c530 (trbD)
Secretion system [BR:acx02044]
 Type IV secretion system
  Trb secretion system protein
   Achr_c530 (trbD)
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: AJE23534
UniProt: A0A0C4WS89
LinkDB
Position
pAcX50c:complement(60922..61233)
AA seq 103 aa
MALRTIPIRRAGNRDNLFMGGDRELVMFSGLLAFALIFSAQELRATVVGFVLWFGSLFVL
RIMAKSDPKLRFVYLRHRRYKSFYPARSTPFRDNTTSQGNQYK
NT seq 312 nt   +upstreamnt  +downstreamnt
atggctctccgcacgatccccattcggcgggctggcaatcgagacaacctgttcatgggt
ggggaccgtgaactggtgatgttctcgggcttgctggccttcgcactgatcttcagtgcg
caagaactgagggcaacggtggtgggctttgtgttgtggttcggatcgctctttgtgctc
cgaatcatggccaagtcggacccaaagctgcggttcgtctacctccgtcaccgtcgctac
aagtcgttctatccggctcgtagcacgcccttccgagacaacactacaagccaaggaaac
caatacaaatga

KEGG   Azotobacter chroococcum: Achr_c540
Entry
Achr_c540         CDS       T03640                                 
Symbol
trbC
Name
(GenBank) Conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_c540 (trbC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_c540 (trbC)
Secretion system [BR:acx02044]
 Type IV secretion system
  Trb secretion system protein
   Achr_c540 (trbC)
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: AJE23535
UniProt: A0A0C4WUG1
LinkDB
Position
pAcX50c:complement(61236..61640)
AA seq 134 aa
MYALVQAPRLNRQAMFYIGLTLLLAFFLVMPQHAFATEGTGGSLPYESWLTNLRNSVTGP
VAFALSIIGIVVAGGVLIFGGDLNGFFRSLIFLVLVMALLVGAQNVMSTFFGRGAEIAAA
WDVITHSLLLSRTA
NT seq 405 nt   +upstreamnt  +downstreamnt
atgtacgcactcgttcaagccccgcgccttaaccgtcaggcaatgttttatatcggcctg
accttattgctggcttttttcctggttatgccgcagcacgctttcgcgaccgaaggaaca
gggggatcattgccctatgagtcctggctgactaacttgcgcaactccgttactggccct
gtcgccttcgccctctcaatcattggtattgtagttgctggtggcgtgttgatcttcggc
ggtgacctaaacggcttcttccgtagcttgatctttctggtcctggtgatggcgttgctc
gtcggtgcccaaaacgtcatgtctaccttcttcggtcgcggcgctgaaattgccgccgct
tgggacgtgattacccattcgctgctgttgagccggactgcctaa

KEGG   Azotobacter chroococcum: Achr_c550
Entry
Achr_c550         CDS       T03640                                 
Symbol
trbB
Name
(GenBank) Conjugal transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:acx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_c550 (trbB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_c550 (trbB)
Enzymes [BR:acx01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Achr_c550 (trbB)
Secretion system [BR:acx02044]
 Type IV secretion system
  Trb secretion system protein
   Achr_c550 (trbB)
SSDB
Motif
Pfam: T2SSE FtsK_SpoIIIE AAA_16 AAA_29 AAA_7 AAA_19 DUF87 ResIII Pox_A32 DEAD TrwB_AAD_bind RsgA_GTPase AAA_22 Sigma54_activat AAA_30 Bac_DnaA P-loop_TraG ABC_tran TsaE AAA_23 NACHT PduV-EutP MMR_HSR1 AAA GTP_EFTU AAA_28 ATPase RuvB_N cobW UvrD-helicase ATPase_2 AAA_10 Zeta_toxin DUF815 IstB_IS21 Septin AAA_11 ATP-synt_ab AAA_8 ATP_bind_1 Adeno_IVa2 NB-ARC Sigma54_activ_2 G-alpha RNA_helicase NTPase_1
Other DBs
NCBI-ProteinID: AJE23536
UniProt: A0A0C4WS35
LinkDB
Position
pAcX50c:complement(61659..62621)
AA seq 320 aa
MHESNEEHSSLKERARKKLERDAGALIIDALNDPKTVELMCNADGKLWVERLGEPMKEIG
QLRPAQAESIIKTVAGYHGKEVTRQNPLLEGEWPLDGSRFAGQLQPVVRAPTFAIRKKAV
AIHTLDEYVEAEIMTADQCSVIKRVVQQHRNILIIGGTGSGKTTLVNAVINEIVVQFPAE
RVFIIEDIGEIQCAAANFVQYHTTLGVTMTELLRTTLRMRPDRILVGEVRGEEALDLLDA
WNTGHPGGAATLHADSAVEGLTRLKSLVSRNRSAPSEIEPLIGKAVHVVVFIARTPKGRR
IQEILEVSGYADGCYQLHNL
NT seq 963 nt   +upstreamnt  +downstreamnt
atgcacgagagcaacgaagaacattccagcctcaaagagcgggcaaggaagaaactcgaa
cgggacgcgggggcgctcattattgacgcactcaacgatccgaagactgttgaactcatg
tgcaacgcagacgggaaactctgggttgagcgcctgggcgagcccatgaaggagattggc
cagcttcgcccggctcaggctgagtcgatcatcaagacggtcgctggctaccacggcaag
gaagtaacccgccagaatccgctgctggaaggggagtggccattagacgggtcacgtttt
gccggccagcttcagcctgttgtgcgtgcccccactttcgctatccgtaagaaggccgtg
gccatccataccctcgacgagtacgtcgaggcggaaatcatgactgcggatcaatgcagt
gtgatcaagagggtggttcagcaacaccgaaacattctgatcatcggcggtacaggatct
ggcaagaccaccctagtcaacgccgtaatcaatgaaatagtcgtccagttcccggcagaa
cgcgtgttcatcatcgaggacatcggggaaattcagtgtgcggccgcaaacttcgtgcaa
taccacaccacgctcggcgtgaccatgaccgagttgctgagaaccacgctgcgtatgcgt
cccgaccgcattctggttggcgaagtgcgcggcgaggaagcgcttgatctacttgacgca
tggaatactgggcacccaggcggtgccgcgacccttcacgccgacagcgcggtggaagga
ttgactcgcttgaagtcacttgtttcacgaaacaggtcggctccatccgaaattgagccg
ctgattggcaaggcggttcacgttgttgttttcatcgctagaaccccaaaaggccgacgc
atacaggaaattcttgaagtttccgggtacgccgatggctgctatcaactccataacctt
taa

DBGET integrated database retrieval system