KEGG   Anser cygnoides domesticus (swan goose): 106040210
Entry
106040210         CDS       T04896                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
acyg  Anser cygnoides domesticus (swan goose)
Pathway
acyg04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:acyg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106040210 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:acyg04050]
    106040210 (TNFRSF8)
   04090 CD molecules [BR:acyg04090]
    106040210 (TNFRSF8)
Cytokine receptors [BR:acyg04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   106040210 (TNFRSF8)
CD molecules [BR:acyg04090]
 Proteins
  106040210 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 KIAA1328
Other DBs
NCBI-GeneID: 106040210
NCBI-ProteinID: XP_013043373
LinkDB
Position
Unknown
AA seq 494 aa
MPLQMASCSLVPGLWLLLLLQDIQGAPQPSLTSSGSCDTLRNWFYDETLQRCCYRCPSGY
AKKKACPTDPDEDCMRCGPEQYLNEESQKPHCDACVSCTKESDLVEKVPCSFNSSRVCEC
RPGLFCQTAVKYTCMRCQQHTACKPGFGVKVRGTSTTDVSCEECPPGTFSDQNSSTDICK
PHTDCAKLNKVAQSKGNATHDQVCLDQLPTYLTPGTFSTRLSNETSNSDLLRLEANLVTI
SSILLSAATTENPSSTPNENALAGTLPTSDKGETTTGVGLVWGVVLSVMLLLVGMLLFWK
WKICKKRILILKGKPHLTSHKSRIRSHGSDLVNGIPKQITFFSNKIMLTTDQGPEEKELI
ERNVPLETNNNLVSSTEKAYSPDLSLTDVTQSNGNAPDCPVDSRVRDHTNNRIEKIYIMK
ADTVIVGSISEVPGSKNCAARGCESDVDIQENTEEELAMHYPEQETESFPGNDVMVPVEE
EGKEFHHPTTATEK
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgccactgcagatggcttcttgcagccttgtaccgggactgtggctcctgctgcttctc
caggatatccagggagccccacagccatcactcacctcatctggttcctgtgatacactc
aggaattggttctatgatgaaactttacaaaggtgctgttaccggtgcccctcagggtat
gctaaaaagaaagcatgtcccacggacccagatgaagactgcatgagatgtggacctgag
caatatctgaacgaagaatcccaaaagccacattgtgacgcttgtgtgtcatgtacaaaa
gaatctgaccttgtggagaaagtgccctgctccttcaattctagccgcgtgtgtgagtgc
cgaccaggtctgttctgtcaaaccgctgttaagtacacctgcatgcgatgccagcagcac
actgcctgcaagcctggttttggagttaaagtcagaggcacctcaacaactgatgtttct
tgtgaagaatgcccccctgggaccttctctgaccaaaactccagcactgacatctgcaag
ccccatactgactgtgccaagttaaacaaagtagcacaaagcaaaggaaatgccacacat
gatcaggtttgcctggaccaattgcccacctacctcaccccaggcactttctccaccaga
ctcagcaatgaaacaagtaactctgacctactgaggcttgaggcgaacttggtcactatt
tctagtattcttttaagtgctgcaacaactgaaaaccccagttctactcccaacgagaat
gctctggctggcacgcttcccacctcagacaagggggagacaacaacaggagtaggtctt
gtttggggagtggttctctctgtgatgctgctacttgtgggcatgctgttgttttggaaa
tggaagatttgcaagaaacgaatcctcatcctcaaaggaaaaccacatctcacttcacac
aaatccaggatcagatctcacggttctgatctggtgaacggtattccgaaacagatcact
ttcttttccaataagatcatgcttactactgatcaagggccagaagagaaggagctaatt
gaaagaaacgttcctttggaaaccaataacaacttggtttccagcacagaaaaagcatat
agtcctgatttgagtctgactgatgtgacacagagcaatggaaatgccccagattgccct
gtcgattctcgagtgagagaccacacaaataatcgaattgaaaaaatatacatcatgaag
gccgatactgttatagtggggtccatttcagaagtgcctggtagcaagaactgtgctgct
aggggatgtgaaagtgatgttgatatccaagaaaacacggaagaggaattggcgatgcac
tatccagagcaggagacagagtcttttccagggaatgatgtcatggttcctgtggaagag
gagggaaaggaattccatcaccccaccactgccactgaaaagtga

DBGET integrated database retrieval system