KEGG   Anser cygnoides domesticus (swan goose): 106043403
Entry
106043403         CDS       T04896                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
acyg  Anser cygnoides domesticus (swan goose)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 106043403
NCBI-ProteinID: XP_013048297
LinkDB
Position
Unknown
AA seq 106 aa
MANRTNSSEYFWSYEYYWDYIDPIPVDGRKLKVNKYSIVIAFWVGLAAFVMFLFLILLYM
SRSGSSPVKQVIVGNQTEESSSNSEQPHCEDLSSPYTDAVAPGTPN
NT seq 321 nt   +upstreamnt  +downstreamnt
atggccaacagaaccaactcgtctgagtacttttggtcctatgagtattactgggactac
atagacccgatcccagtggatggaaggaagctgaaggttaataaatattctattgtcata
gccttttgggttggacttgctgcctttgtgatgtttcttttccttattttgctgtatatg
tcccgctctggatcaagtccagtaaaacaggtgattgtagggaaccagacagaagaaagc
agttccaacagtgaacagcctcattgcgaagacctcagcagcccatacacagacgcagtt
gctcctggaacacctaactaa

DBGET integrated database retrieval system