KEGG   Acropora digitifera (stony coral): 107334727
Entry
107334727         CDS       T04352                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04140  Autophagy - animal
adf04141  Protein processing in endoplasmic reticulum
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107334727
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107334727
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107334727
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:adf01009]
    107334727
Protein phosphatases and associated proteins [BR:adf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107334727
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 107334727
NCBI-ProteinID: XP_015755186
LinkDB
Position
Un
AA seq 192 aa
MAPLEICRTPNMSANRKTKNQEDRNARDLACDYIYYNKLGKEEFRMNTKVAATLRRIGRE
VEIRHQLILKNMCGKLDIRASSAQVTFRTVADEIFATGINWGRIVVLFCFAAEVAVFCRQ
QEIDVVENIVTWLSEYLSQRTLSEWIKKSGGWEAFSEQFKDVRDEREKFWWNSLLYTTLG
LGTLAAVFYVKS
NT seq 579 nt   +upstreamnt  +downstreamnt
atggccccgttggaaatctgccgcactcccaacatgtctgcaaacagaaagacaaaaaac
caagaggacagaaatgctagggacttagcatgcgactacatttattataacaaacttgga
aaggaagagtttaggatgaacacaaaggttgcggctactctccgtagaatagggagagaa
gttgagatacggcatcaactcatactgaaaaatatgtgtgggaagctcgatatcagagcg
tcttcggcccaagttacgttcagaactgtggcagatgaaatattcgccacgggaataaac
tggggtcgtatagtcgttctgttttgctttgcggccgaagttgctgttttctgtaggcaa
caagagattgacgttgttgaaaatattgttacgtggctttcggagtatttaagccaaaga
acgctatctgaatggataaagaaatcaggcggatgggaagctttctcagaacagttcaaa
gacgttcgagatgagcgtgagaaattttggtggaacagcctactttatacaactcttgga
cttggtaccctggctgcagtgttctatgtgaagagttag

KEGG   Acropora digitifera (stony coral): 107358260
Entry
107358260         CDS       T04352                                 

Definition
(RefSeq) apoptosis regulator R1-like
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04137  Mitophagy - animal
adf04140  Autophagy - animal
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107358260
   04137 Mitophagy - animal
    107358260
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107358260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:adf01009]
    107358260
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:adf03036]
    107358260
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adf02000]
    107358260
Protein phosphatases and associated proteins [BR:adf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107358260
Chromosome and associated proteins [BR:adf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107358260
Transporters [BR:adf02000]
 Other transporters
  Pores ion channels [TC:1]
   107358260
SSDB
Motif
Pfam: Bcl-2 BH4
Other DBs
NCBI-GeneID: 107358260
NCBI-ProteinID: XP_015780361
LinkDB
Position
Un
AA seq 211 aa
MAGATAALNNEDLSPTLSTSELSRYDKDIVNDGYSLTVDYVSYRLRNKFEQNKLNGLPRK
FLIPQSPISASSSTLRKLATLMEAEHPDLFESLCTTLGITPNTAHPTFVGVAQEIFQAGI
NWGRIVALFTFGGVVAHHFVEIQRLEMVQRIVEWIADFIEHNLLTWIRENGGWDGFVAHF
SDSSQSQFTWKSLVTVGSICAAGLTLLALNK
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccggagcaacagctgcgctgaacaacgaagatctttccccaacactgagcacctcg
gaattgtcaagatacgacaaggatatcgtcaacgatggttattcactaactgtggactat
gtttcttaccgactaaggaacaaattcgaacaaaacaaactcaatggattaccgcgaaaa
ttccttattcctcaatcacctataagcgcatcatcgagcactctacgaaaactggcaact
cttatggaggctgaacaccccgacttgttcgaatcattgtgcacaacgctaggaataaca
ccaaatacagcgcatcctacgtttgtcggtgttgcacaagagatctttcaagccggaatc
aactggggcaggatagtggcccttttcacgttcggaggtgtagtggctcatcacttcgtg
gaaattcagcgactagaaatggtgcaacgcatcgtggaatggatcgctgactttattgaa
cataacttgctgacatggatcagagagaatggtggctgggatgggtttgttgctcacttt
tccgactcctcgcagtctcaattcacatggaagagcttagtcactgttggaagtatttgt
gcagcgggtcttactcttctggcattaaacaagtga

DBGET integrated database retrieval system