KEGG   Acropora digitifera (stony coral): 107335505
Entry
107335505         CDS       T04352                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein-like
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107335505
SSDB
Motif
Pfam: Bcl-2 Mt_ATP-synt_B
Other DBs
NCBI-GeneID: 107335505
NCBI-ProteinID: XP_015756010
LinkDB
Position
Un
AA seq 224 aa
MLKSVTKRLKPFIEAKLNEEYVSIANDGNLYCLDYIEQRLKRSNIESGLAFIRPEVVSPE
ISSVSAKITEIGELLESSYPHLYNNVSKQLKVKLRSEVIVGDVFRNFGRELFRDGVTWCR
IVSLFAFSASISTDCIVQGRPELVKSVLSCVRLYVLDHLAVWIRGQGGWIELTKKFKCIE
KRYSLAFFVRWFGQSSRWMIKSTADTLKSLLYKVNEFIGLINSG
NT seq 675 nt   +upstreamnt  +downstreamnt
atgttgaagtcagtgaccaaaaggctaaaaccttttattgaagcaaaacttaacgaggaa
tacgtctcaattgcgaacgatggaaatttatattgcctcgattacatcgagcagcgactg
aaacgctcaaatatagagtctggtcttgcatttatacggccagaagtggtgtctccagaa
atatcctcagtttcagcgaaaataaccgagatcggcgagcttctggagtcttcataccca
catctgtacaacaatgtttcaaaacagctcaaggttaagctgcgaagcgaagtgatcgtc
ggtgacgtttttcggaactttggccgcgaattatttcgtgacggagttacttggtgtagg
atcgtttcactgtttgcattttctgcttctataagcactgactgcatcgtacagggccga
ccagaactggtgaaaagcgttttaagctgtgttcgactttacgttttggaccatttggct
gtctggattagaggacagggaggatggattgaattgacaaagaagttcaagtgtatcgag
aagcgatactcgctggcgtttttcgtgaggtggtttggccaaagcagtagatggatgatc
aagtcaacagctgacactttgaagtcgctgctttataaagtaaatgaattcattgggctc
ataaacagtggctag

KEGG   Acropora digitifera (stony coral): 107344795
Entry
107344795         CDS       T04352                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein-like
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107344795
SSDB
Motif
Pfam: Bcl-2 RecO_C
Other DBs
NCBI-GeneID: 107344795
NCBI-ProteinID: XP_015765969
LinkDB
Position
Un
AA seq 254 aa
MSTIRRAKMVKRLSWQDMSPSSPKIRLTRRIVQLEGEKISAEILRQAKTICNEYIEAKLE
RDGFTSRSLSPNSPTEVTSRKNSEVSHRIQEIGELLELGYPELYMNISSQLNVSFSNENA
VHEAFNNVSSEILSDGVNWPRIVAVYAFCGALVCECYKEGRNSFVLNMGNWMYEFAALHF
VEWIKLQGGWEDVLLAFPKVATSRGYPLVITEANRWRNYLVVQLKTWCEIGFAFLRHFKA
YLRKVPVGLRKPSN
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtcgacgatacgacgcgcaaaaatggtgaaacggctgagttggcaggatatgtcacca
tcaagcccaaaaattcgtttgacgagacgaattgtacagcttgaaggtgaaaagatctcc
gctgaaatcctcagacaggcgaaaacaatatgcaatgaatacatcgaagctaaactcgaa
agagatggattcacgagccggagtttgtcgcccaactctccgacggaagttacttcccga
aaaaattccgaagtttcacaccgaattcaagagattggagagttactcgaactgggatac
cctgaattgtacatgaatatctctagccagctaaacgtgtcttttagtaacgaaaacgcc
gtccacgaggcttttaataacgtttcatcagaaatattgagcgatggagttaactggcca
cgaattgttgccgtgtacgcgttctgcggcgcacttgtctgtgaatgttacaaagaaggc
cggaactcatttgtcctcaacatgggtaactggatgtacgaatttgccgccttgcatttc
gttgaatggatcaaacttcaaggtggctgggaagacgtattgctggccttcccgaaggtg
gcgacatcccgcgggtaccctcttgtcattactgaagccaatcgttggcgcaattatctt
gttgtgcaattgaagacctggtgcgagataggttttgcgttcctgagacatttcaaagct
tatttgcgaaaagtaccagttggcttaagaaaacccagcaattga

DBGET integrated database retrieval system