KEGG   Acropora digitifera (stony coral): 107337705
Entry
107337705         CDS       T04352                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16-like
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107337705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:adf04050]
    107337705
   04090 CD molecules [BR:adf04090]
    107337705
Cytokine receptors [BR:adf04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   107337705
CD molecules [BR:adf04090]
 Proteins
  107337705
SSDB
Motif
Pfam: TNFR_c6 Death DUF5383
Other DBs
NCBI-GeneID: 107337705
NCBI-ProteinID: XP_015758412
LinkDB
Position
Un
AA seq 386 aa
MGMLRFLAFLECLSIAACSCPPNLFKSSIDDACCDYCSPGSFMKKECEGSSKPTQCERCP
GNSFTSKPNNVNFCKPCRKECGSGKVLKANCTNTADSLCHCPPGKFWDNLLLQCSSCTKC
DAGQQMIVECQEEKDRVCETCEKGTYLKDNKCVPCSYCRQGEVVVKECTAARDTECQTPG
LPQPTKLCRCNCKKSKTTQTTWHSTKPSTVTVRDAPSEGQQVVDERVDGWGPIMWILIGT
IVVLIMVVALLLILLCKGRRKYSVCELHGKKDAISTDIAESAVKENNVLFRFVRADIVER
LGRMLNSKSGKNWKHLAGKMGYSSADTQAWSVLPNEAAQSLLYDWSQRNGSTVYALYQML
KELRRDDAAALILPLLVDQRVEGEPV
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgggtatgctaagatttttagcattccttgagtgtttaagcatagctgcatgtagttgt
ccaccaaatttgttcaagtcctctatcgacgatgcttgttgtgattattgctcccctgga
tcttttatgaagaaagaatgtgaaggatcatcgaagccaacacagtgtgaacgctgtcct
ggaaactctttcactagcaagccgaacaacgttaatttctgcaagccctgcagaaaggaa
tgtggaagtggaaaagttcttaaggcaaattgtactaacacagcagatagcctgtgccat
tgccctccaggcaagttctgggacaaccttttactgcagtgctcatcttgcaccaaatgt
gatgctggacagcaaatgattgtggaatgccaggaagaaaaggacagagtatgtgagact
tgtgaaaaggggacatacttgaaagacaataaatgtgtgccttgtagttactgccgtcaa
ggtgaagtggttgtgaaagagtgcacagcagcccgtgatactgagtgtcaaacacctggt
ttgccacaaccaacaaagttgtgtagatgtaactgtaaaaaatcaaagacaactcaaaca
acatggcacagcacaaaacccagtactgttactgtaagagatgccccttcagagggtcaa
caagtggtagacgaacgagttgatggttggggcccaataatgtggattcttattggtact
atagttgttttgataatggtggtggccttgttattgatattgctttgtaaaggacgaaga
aagtacagtgtatgtgagcttcatggaaagaaagatgcaatttcaacggatattgcagaa
tcagctgtaaaagaaaataatgtcctgtttagatttgtccgagctgatatagtagagaga
ttaggacgcatgttgaattccaagtcaggaaagaactggaagcatttggcgggtaagatg
ggatacagtagtgcggacacacaagcctggagtgttcttccaaatgaggcagctcaaagc
ctcctttatgattggtcgcaacgaaatggttctaccgtatatgcactgtatcaaatgttg
aaagaactccgcagggatgacgcagcagctttgattcttcctcttcttgttgatcaaagg
gttgaaggtgaacctgtgtaa

KEGG   Acropora digitifera (stony coral): 107342765
Entry
107342765         CDS       T04352                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16-like
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107342765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:adf04050]
    107342765
   04090 CD molecules [BR:adf04090]
    107342765
Cytokine receptors [BR:adf04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   107342765
CD molecules [BR:adf04090]
 Proteins
  107342765
SSDB
Motif
Pfam: TNFR_c6 MpPF26
Other DBs
NCBI-GeneID: 107342765
NCBI-ProteinID: XP_015763742
LinkDB
Position
Un
AA seq 440 aa
MEHSATILKGFLLASVPNLSSSRPTKCGPSQYTVFNPQNQEEIVKCQDCPTCPRGEGVPE
QCGSRVPDGTSTQCKPCELGKSYSSTTDSSTCLSCHECGKKTVLQQCSLTENRKCGECPA
NYFLERHLNDCVECFTCCSDVPDSERMEQCGKDLGLPASQWCEPNEKNKLCAKLNAAKND
EANKTTTSTSAIVSPTSTSTVSLVESSRSSISINESTIATNLAGKNGQIGNPSAAILISS
SCICILAILILAIILIYKKWSARKTSSTNRNEEYVEVETENPEVQQSNNMNMSINVDDIP
QGNPQGQEMVNFDMSNIENIPEELLITDIRNLFWINNGDIEDVMIFQVQNKLDIPETVQK
KTWRSVFLALKVHPDHFNKILSSGDTTFAAIDYFETLGLQQPKLRTFVRALLVCGRNDLA
RIICDWPYKNNEDTNCETQV
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggaacactcagcgactattctcaagggatttttgctagccagtgttccaaatctctct
tcttcacgtccaacaaagtgtggaccatcacaatacacagtattcaaccctcaaaaccaa
gaggaaattgtcaagtgccaagactgtccaacatgcccaagaggtgagggtgtccctgag
caatgtggcagcagagttccagatggaacatccacacaatgcaaaccttgtgaacttggc
aagagttattcaagcacaactgactcatcaacttgcctttcctgccatgagtgtggaaag
aagactgtactgcagcagtgcagtctaactgaaaatcgtaaatgcggagaatgccctgca
aattacttcttggagcggcatcttaatgactgcgtggaatgtttcacatgctgcagtgac
gtcccagacagtgagcgaatggaacagtgcggcaaagatcttgggttgccggcatcccaa
tggtgtgaacctaatgagaaaaataaattatgtgccaaactgaatgcagcaaaaaatgac
gaggcaaacaagactaccacttcaacatcagcaattgttagtccgacaagtaccagtaca
gtttctttagttgaatctagtagaagcagcatttccatcaatgagtcaaccattgctaca
aatttggctggtaaaaatggccaaattggaaacccttcagcagcaatattaatttcctca
tcatgcatatgtatactagctattttgattttggctattattctcatctataagaaatgg
tctgccaggaaaacaagttctacaaacaggaatgaggagtatgttgaagtagagacagaa
aaccctgaagtgcaacagagcaacaatatgaacatgagcatcaatgttgatgacattcct
caaggaaacccccagggacaagagatggtcaactttgacatgtcgaacattgagaatatt
cctgaagagttgctgattactgacataaggaacttgttctggataaataatggggacatc
gaggatgtgatgatctttcaggtccaaaacaagcttgatatcccagagactgttcaaaag
aagacatggcgcagcgtgtttctggccttaaaggtgcatccagatcattttaacaagata
ttaagtagcggagacacaacttttgcagctatcgattacttcgaaacactgggtctccaa
caaccaaaactgagaacatttgtgagagcacttcttgtgtgtggaaggaatgatctagct
agaattatatgcgactggccatacaagaacaacgaagacacaaactgtgaaacgcaagtt
taa

KEGG   Acropora digitifera (stony coral): 107352037
Entry
107352037         CDS       T04352                                 

Definition
(RefSeq) uncharacterized LOC107352037
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107352037
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:adf04050]
    107352037
   04090 CD molecules [BR:adf04090]
    107352037
Cytokine receptors [BR:adf04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   107352037
CD molecules [BR:adf04090]
 Proteins
  107352037
SSDB
Motif
Pfam: TNFR_c6 Death Tmemb_9 JTB RCR Orf78 DUF6377 DUF3413 Pox_EPC_I2-L1 DUF5383
Other DBs
NCBI-GeneID: 107352037
NCBI-ProteinID: XP_015773825
LinkDB
Position
Un
AA seq 468 aa
MKPTSDILSTVASVILLLSLITLGSCEISRRRKPGEDEIERVVNKTHSIFWQCPSCNPGD
GLSVKCGTSVSIHVSIECKPCKLNVTYSDTDDHSICKPCRHCKEHENMTGFCSVVKDTTK
CLGSCEKGYYWTNNSCQPCQHCKEHENMTGFCSAYKDTVKCLPSCEKGYYWTNNSCHPCS
ECCKNNISINHEKQCEDSGLPDNHQCQKTEPICQNVSPKEENRDEKVYIWIIIIIIIIIV
IILIFIVVIWKRDGWQGFKARITSCFCCSFTSTHPTYNMDLTSNSGQSSSLEMASSCDSE
VLSGTTATSRTASLESGNEILKKPYKPSSPAKKTQYTSTTGLYSGSTIIDIDPVPESFRK
ELLSNRVSRIPIQPFYQRICAKLDCERAFFYDFRLLGEKIGLDRNETSLLATKGNPTHSI
LEIYDSQKGSSIGKLRKFLEEMDRYDVVTVIDEWIDHEWKRVVSSSLT
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgaagccaacgtctgacattctttcaaccgttgcgtcggttattttgttgctatccctg
atcactctggggagctgcgaaatatcccgccgtcgcaagccaggagaagatgagattgaa
agagtagtgaataaaactcattcaatcttttggcaatgccctagctgtaatccaggagat
ggactcagtgtcaaatgtggcacaagtgtttcaatccatgtatccattgaatgcaaacca
tgcaagctgaacgtcacctattcagacactgatgatcattccatttgtaaaccctgccgg
cattgcaaggaacatgaaaacatgacaggattctgcagtgttgtcaaggacacaacaaaa
tgcttaggatcctgtgagaagggatattactggacaaacaacagctgtcaaccatgccag
cactgcaaggaacatgaaaatatgacaggattctgtagtgcttacaaggacacagtaaaa
tgcttaccttcctgtgagaaaggatactactggacaaacaacagctgtcacccatgcagt
gaatgttgtaaaaacaacatttccatcaaccacgagaaacagtgtgaagattctgggctg
ccagacaatcatcagtgtcagaaaacagaacctatatgccaaaatgtttcaccaaaagag
gagaatcgagatgaaaaggtttacatttggataataattatcatcataataattattgtt
atcatattaatttttattgtcgtgatatggaaaagagatggttggcagggatttaaagca
agaatcacatcctgtttttgttgttctttcacctctacacatccaacttacaacatggat
cttacttcaaattctggtcagagttcttcgttggaaatggccagttcctgtgatagtgag
gtactttctggtactacagccacaagcagaacagcttccttggaatcagggaatgaaatt
ctcaaaaagccatacaaaccttcttctccagccaagaagacacaatatacatcaacaaca
ggactttatagtgggtcaacaataattgacatcgacccagttccagaatcctttcggaaa
gaactcttgagtaaccgggtatcaaggattcccattcaaccattttatcaaaggatttgt
gctaaacttgattgtgaaagggcctttttttatgattttcgtcttttgggtgaaaagatt
ggcctggacagaaatgaaacttcacttttagctacaaaaggtaatcctacacattcaatt
cttgaaatatatgatagccagaaaggcagttccattggaaaattaagaaaatttctggag
gaaatggatagatatgatgtagtgacagttattgatgaatggattgatcatgaatggaaa
cgagttgtgagcagctctttaacgtag

KEGG   Acropora digitifera (stony coral): 107352076
Entry
107352076         CDS       T04352                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16-like
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107352076
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:adf04050]
    107352076
   04090 CD molecules [BR:adf04090]
    107352076
Cytokine receptors [BR:adf04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   107352076
CD molecules [BR:adf04090]
 Proteins
  107352076
SSDB
Motif
Pfam: TNFR_c6 Death MARVEL
Other DBs
NCBI-GeneID: 107352076
NCBI-ProteinID: XP_015773868
LinkDB
Position
Un
AA seq 453 aa
MVGQSDEIYVQTLSRDIISNSAMRLQIVPAIICVCALLWSCVTVLSCPEGTYEGKNGLCC
NLCPQGTHLISPCNNKSQISSCQPCPSQTFMDKENNEAKCLPCTRCEPTQVALLECSANQ
NRKCGCETGTFLELSFLVCVKCKKCPRGEGVESNCSGSSDTKCAPCLEGRTFSDVESFTE
PCKNCTQCDGMAMNDECSLSRDTICETAYATVAATTTSSTTSSTTSSTTSITSVSLPEAA
GEVDAVKTGQEDSDVISPQYKIGLSLALGILGFSVAVILVALKFFYIKKIRNDNVSVCYR
TEGTVVTGLNFPVAATSSSLRGLRGRKTTSGRISNCHGRESDSQGSNCSLQGVSIGGGSG
KSKTLVRDLPGHIYFELGRFLNPKSRNNWMILAGRLGFTDSDVKNFDTYPDQATQRVLDE
WGQREGSTVNALICELKEMKRDDCVQVLKAWES
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggtgggtcagtcagatgagatctatgttcaaactctctctcgtgatatcattagtaat
tcagcaatgaggctgcaaatagtacctgcgatcatctgtgtatgtgctctcctctggtcc
tgtgttactgttctctcttgtcctgaggggacctatgaagggaaaaatggtttgtgctgt
aatctgtgtccacagggaacccacttgatatcgccttgcaataacaagtcacagatttcc
tcctgtcaaccctgcccgtcacaaacctttatggataaagaaaacaatgaagcaaagtgt
ttgccttgcacacgctgtgaaccaacacaggttgcattgttggagtgcagcgcgaaccag
aatcggaaatgtggatgtgaaacaggaacatttctcgagctatcctttctcgtctgtgtg
aaatgcaaaaaatgcccgagaggagagggtgtggagtctaattgttcaggatcttcggac
acaaaatgtgcgccttgcttggaggggcgcacgttctcagacgttgagtcctttacagaa
ccttgtaagaattgcacgcaatgtgatggtatggcaatgaatgatgaatgcagtttatca
cgagataccatatgtgaaacagcctatgcaactgttgctgcaacgacaacatcatcgaca
acatcatcgacaacttcatcgacaacttcaatcaccagtgtatctctaccggaagctgca
ggtgaggtggatgcagttaaaactggccaggaagattcggacgtcatatctccacagtat
aaaataggcctttctttagcccttggtattcttggattctccgttgcagtcattttggtt
gctctgaagttcttttatatcaagaaaatacggaatgataacgtttccgtttgctatcgt
acagaaggaactgtggtcacaggattaaattttcccgtagcagcaacatccagttccttg
cgtggactgcgcggaaggaagacgacgagtgggaggatctctaattgccacggccgagaa
tcagactcacaagggagtaactgctcgctgcagggggtcagcatcggaggaggcagtgga
aaaagcaagacgttggttcgcgatctgcccggtcacatttattttgagttaggaagattc
cttaacccaaagtctcgcaataactggatgatacttgcgggaagattgggattcactgac
agcgatgtgaaaaactttgatacttatcctgaccaggcgacacagagagttctggatgag
tggggacagagagaaggctccacggttaatgctttaatctgtgagttgaaagaaatgaaa
agagacgattgtgttcaggtccttaaagcatgggagagctga

DBGET integrated database retrieval system